 Directories
      ¶
      Directories
      ¶
    
    | Path | Synopsis | 
|---|---|
| Package acm provides the client and types for making API requests to AWS Certificate Manager. | Package acm provides the client and types for making API requests to AWS Certificate Manager. | 
| 
          
            acmiface
            
            
          
           Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code. | Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code. | 
| Package alexaforbusiness provides the client and types for making API requests to Alexa For Business. | Package alexaforbusiness provides the client and types for making API requests to Alexa For Business. | 
| 
          
            alexaforbusinessiface
            
            
          
           Package alexaforbusinessiface provides an interface to enable mocking the Alexa For Business service client for testing your code. | Package alexaforbusinessiface provides an interface to enable mocking the Alexa For Business service client for testing your code. | 
| Package apigateway provides the client and types for making API requests to Amazon API Gateway. | Package apigateway provides the client and types for making API requests to Amazon API Gateway. | 
| 
          
            apigatewayiface
            
            
          
           Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code. | Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code. | 
| Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling. | Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling. | 
| 
          
            applicationautoscalingiface
            
            
          
           Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code. | Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code. | 
| Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service. | Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service. | 
| 
          
            applicationdiscoveryserviceiface
            
            
          
           Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code. | Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code. | 
| Package appstream provides the client and types for making API requests to Amazon AppStream. | Package appstream provides the client and types for making API requests to Amazon AppStream. | 
| 
          
            appstreamiface
            
            
          
           Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code. | Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code. | 
| Package appsync provides the client and types for making API requests to AWS AppSync. | Package appsync provides the client and types for making API requests to AWS AppSync. | 
| 
          
            appsynciface
            
            
          
           Package appsynciface provides an interface to enable mocking the AWS AppSync service client for testing your code. | Package appsynciface provides an interface to enable mocking the AWS AppSync service client for testing your code. | 
| Package athena provides the client and types for making API requests to Amazon Athena. | Package athena provides the client and types for making API requests to Amazon Athena. | 
| 
          
            athenaiface
            
            
          
           Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code. | Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code. | 
| Package autoscaling provides the client and types for making API requests to Auto Scaling. | Package autoscaling provides the client and types for making API requests to Auto Scaling. | 
| 
          
            autoscalingiface
            
            
          
           Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code. | Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code. | 
| Package batch provides the client and types for making API requests to AWS Batch. | Package batch provides the client and types for making API requests to AWS Batch. | 
| 
          
            batchiface
            
            
          
           Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code. | Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code. | 
| Package budgets provides the client and types for making API requests to AWS Budgets. | Package budgets provides the client and types for making API requests to AWS Budgets. | 
| 
          
            budgetsiface
            
            
          
           Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code. | Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code. | 
| Package cloud9 provides the client and types for making API requests to AWS Cloud9. | Package cloud9 provides the client and types for making API requests to AWS Cloud9. | 
| 
          
            cloud9iface
            
            
          
           Package cloud9iface provides an interface to enable mocking the AWS Cloud9 service client for testing your code. | Package cloud9iface provides an interface to enable mocking the AWS Cloud9 service client for testing your code. | 
| Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory. | Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory. | 
| 
          
            clouddirectoryiface
            
            
          
           Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code. | Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code. | 
| Package cloudformation provides the client and types for making API requests to AWS CloudFormation. | Package cloudformation provides the client and types for making API requests to AWS CloudFormation. | 
| 
          
            cloudformationiface
            
            
          
           Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code. | Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code. | 
| Package cloudfront provides the client and types for making API requests to Amazon CloudFront. | Package cloudfront provides the client and types for making API requests to Amazon CloudFront. | 
| 
          
            cloudfrontiface
            
            
          
           Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code. | Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code. | 
| 
          
            sign
            
            
          
           Package sign provides utilities to generate signed URLs for Amazon CloudFront. | Package sign provides utilities to generate signed URLs for Amazon CloudFront. | 
| Package cloudhsm provides the client and types for making API requests to Amazon CloudHSM. | Package cloudhsm provides the client and types for making API requests to Amazon CloudHSM. | 
| 
          
            cloudhsmiface
            
            
          
           Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code. | Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code. | 
| Package cloudhsmv2 provides the client and types for making API requests to AWS CloudHSM V2. | Package cloudhsmv2 provides the client and types for making API requests to AWS CloudHSM V2. | 
| 
          
            cloudhsmv2iface
            
            
          
           Package cloudhsmv2iface provides an interface to enable mocking the AWS CloudHSM V2 service client for testing your code. | Package cloudhsmv2iface provides an interface to enable mocking the AWS CloudHSM V2 service client for testing your code. | 
| Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch. | Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch. | 
| 
          
            cloudsearchiface
            
            
          
           Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code. | Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code. | 
| Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain. | Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain. | 
| 
          
            cloudsearchdomainiface
            
            
          
           Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code. | Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code. | 
| Package cloudtrail provides the client and types for making API requests to AWS CloudTrail. | Package cloudtrail provides the client and types for making API requests to AWS CloudTrail. | 
| 
          
            cloudtrailiface
            
            
          
           Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code. | Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code. | 
| Package cloudwatch provides the client and types for making API requests to Amazon CloudWatch. | Package cloudwatch provides the client and types for making API requests to Amazon CloudWatch. | 
| 
          
            cloudwatchiface
            
            
          
           Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code. | Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code. | 
| Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events. | Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events. | 
| 
          
            cloudwatcheventsiface
            
            
          
           Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code. | Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code. | 
| Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs. | Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs. | 
| 
          
            cloudwatchlogsiface
            
            
          
           Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code. | Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code. | 
| Package codebuild provides the client and types for making API requests to AWS CodeBuild. | Package codebuild provides the client and types for making API requests to AWS CodeBuild. | 
| 
          
            codebuildiface
            
            
          
           Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code. | Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code. | 
| Package codecommit provides the client and types for making API requests to AWS CodeCommit. | Package codecommit provides the client and types for making API requests to AWS CodeCommit. | 
| 
          
            codecommitiface
            
            
          
           Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code. | Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code. | 
| Package codedeploy provides the client and types for making API requests to AWS CodeDeploy. | Package codedeploy provides the client and types for making API requests to AWS CodeDeploy. | 
| 
          
            codedeployiface
            
            
          
           Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code. | Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code. | 
| Package codepipeline provides the client and types for making API requests to AWS CodePipeline. | Package codepipeline provides the client and types for making API requests to AWS CodePipeline. | 
| 
          
            codepipelineiface
            
            
          
           Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code. | Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code. | 
| Package codestar provides the client and types for making API requests to AWS CodeStar. | Package codestar provides the client and types for making API requests to AWS CodeStar. | 
| 
          
            codestariface
            
            
          
           Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code. | Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code. | 
| Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity. | Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity. | 
| 
          
            cognitoidentityiface
            
            
          
           Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code. | Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code. | 
| Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider. | Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider. | 
| 
          
            cognitoidentityprovideriface
            
            
          
           Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code. | Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code. | 
| Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync. | Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync. | 
| 
          
            cognitosynciface
            
            
          
           Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code. | Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code. | 
| Package comprehend provides the client and types for making API requests to Amazon Comprehend. | Package comprehend provides the client and types for making API requests to Amazon Comprehend. | 
| 
          
            comprehendiface
            
            
          
           Package comprehendiface provides an interface to enable mocking the Amazon Comprehend service client for testing your code. | Package comprehendiface provides an interface to enable mocking the Amazon Comprehend service client for testing your code. | 
| Package configservice provides the client and types for making API requests to AWS Config. | Package configservice provides the client and types for making API requests to AWS Config. | 
| 
          
            configserviceiface
            
            
          
           Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code. | Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code. | 
| Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service. | Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service. | 
| 
          
            costandusagereportserviceiface
            
            
          
           Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code. | Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code. | 
| Package costexplorer provides the client and types for making API requests to AWS Cost Explorer Service. | Package costexplorer provides the client and types for making API requests to AWS Cost Explorer Service. | 
| 
          
            costexploreriface
            
            
          
           Package costexploreriface provides an interface to enable mocking the AWS Cost Explorer Service service client for testing your code. | Package costexploreriface provides an interface to enable mocking the AWS Cost Explorer Service service client for testing your code. | 
| Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service. | Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service. | 
| 
          
            databasemigrationserviceiface
            
            
          
           Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code. | Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code. | 
| Package datapipeline provides the client and types for making API requests to AWS Data Pipeline. | Package datapipeline provides the client and types for making API requests to AWS Data Pipeline. | 
| 
          
            datapipelineiface
            
            
          
           Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code. | Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code. | 
| Package dax provides the client and types for making API requests to Amazon DynamoDB Accelerator (DAX). | Package dax provides the client and types for making API requests to Amazon DynamoDB Accelerator (DAX). | 
| 
          
            daxiface
            
            
          
           Package daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code. | Package daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code. | 
| Package devicefarm provides the client and types for making API requests to AWS Device Farm. | Package devicefarm provides the client and types for making API requests to AWS Device Farm. | 
| 
          
            devicefarmiface
            
            
          
           Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code. | Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code. | 
| Package directconnect provides the client and types for making API requests to AWS Direct Connect. | Package directconnect provides the client and types for making API requests to AWS Direct Connect. | 
| 
          
            directconnectiface
            
            
          
           Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code. | Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code. | 
| Package directoryservice provides the client and types for making API requests to AWS Directory Service. | Package directoryservice provides the client and types for making API requests to AWS Directory Service. | 
| 
          
            directoryserviceiface
            
            
          
           Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code. | Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code. | 
| Package dynamodb provides the client and types for making API requests to Amazon DynamoDB. | Package dynamodb provides the client and types for making API requests to Amazon DynamoDB. | 
| 
          
            dynamodbattribute
            
            
          
           Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues. | Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues. | 
| 
          
            dynamodbiface
            
            
          
           Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code. | Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code. | 
| 
          
            expression
            
            
          
           Package expression provides types and functions to create Amazon DynamoDB Expression strings, ExpressionAttributeNames maps, and ExpressionAttributeValues maps. | Package expression provides types and functions to create Amazon DynamoDB Expression strings, ExpressionAttributeNames maps, and ExpressionAttributeValues maps. | 
| Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams. | Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams. | 
| 
          
            dynamodbstreamsiface
            
            
          
           Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code. | Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code. | 
| Package ec2 provides the client and types for making API requests to Amazon Elastic Compute Cloud. | Package ec2 provides the client and types for making API requests to Amazon Elastic Compute Cloud. | 
| 
          
            ec2iface
            
            
          
           Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code. | Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code. | 
| Package ecr provides the client and types for making API requests to Amazon EC2 Container Registry. | Package ecr provides the client and types for making API requests to Amazon EC2 Container Registry. | 
| 
          
            ecriface
            
            
          
           Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code. | Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code. | 
| Package ecs provides the client and types for making API requests to Amazon EC2 Container Service. | Package ecs provides the client and types for making API requests to Amazon EC2 Container Service. | 
| 
          
            ecsiface
            
            
          
           Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code. | Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code. | 
| Package efs provides the client and types for making API requests to Amazon Elastic File System. | Package efs provides the client and types for making API requests to Amazon Elastic File System. | 
| 
          
            efsiface
            
            
          
           Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code. | Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code. | 
| Package elasticache provides the client and types for making API requests to Amazon ElastiCache. | Package elasticache provides the client and types for making API requests to Amazon ElastiCache. | 
| 
          
            elasticacheiface
            
            
          
           Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code. | Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code. | 
| Package elasticbeanstalk provides the client and types for making API requests to AWS Elastic Beanstalk. | Package elasticbeanstalk provides the client and types for making API requests to AWS Elastic Beanstalk. | 
| 
          
            elasticbeanstalkiface
            
            
          
           Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code. | Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code. | 
| Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service. | Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service. | 
| 
          
            elasticsearchserviceiface
            
            
          
           Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code. | Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code. | 
| Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder. | Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder. | 
| 
          
            elastictranscoderiface
            
            
          
           Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code. | Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code. | 
| Package elb provides the client and types for making API requests to Elastic Load Balancing. | Package elb provides the client and types for making API requests to Elastic Load Balancing. | 
| 
          
            elbiface
            
            
          
           Package elbiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code. | Package elbiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code. | 
| Package elbv2 provides the client and types for making API requests to Elastic Load Balancing. | Package elbv2 provides the client and types for making API requests to Elastic Load Balancing. | 
| 
          
            elbv2iface
            
            
          
           Package elbv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code. | Package elbv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code. | 
| Package emr provides the client and types for making API requests to Amazon Elastic MapReduce. | Package emr provides the client and types for making API requests to Amazon Elastic MapReduce. | 
| 
          
            emriface
            
            
          
           Package emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code. | Package emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code. | 
| Package firehose provides the client and types for making API requests to Amazon Kinesis Firehose. | Package firehose provides the client and types for making API requests to Amazon Kinesis Firehose. | 
| 
          
            firehoseiface
            
            
          
           Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code. | Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code. | 
| Package gamelift provides the client and types for making API requests to Amazon GameLift. | Package gamelift provides the client and types for making API requests to Amazon GameLift. | 
| 
          
            gameliftiface
            
            
          
           Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code. | Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code. | 
| Package glacier provides the client and types for making API requests to Amazon Glacier. | Package glacier provides the client and types for making API requests to Amazon Glacier. | 
| 
          
            glacieriface
            
            
          
           Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code. | Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code. | 
| Package glue provides the client and types for making API requests to AWS Glue. | Package glue provides the client and types for making API requests to AWS Glue. | 
| 
          
            glueiface
            
            
          
           Package glueiface provides an interface to enable mocking the AWS Glue service client for testing your code. | Package glueiface provides an interface to enable mocking the AWS Glue service client for testing your code. | 
| Package greengrass provides the client and types for making API requests to AWS Greengrass. | Package greengrass provides the client and types for making API requests to AWS Greengrass. | 
| 
          
            greengrassiface
            
            
          
           Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code. | Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code. | 
| Package guardduty provides the client and types for making API requests to Amazon GuardDuty. | Package guardduty provides the client and types for making API requests to Amazon GuardDuty. | 
| 
          
            guarddutyiface
            
            
          
           Package guarddutyiface provides an interface to enable mocking the Amazon GuardDuty service client for testing your code. | Package guarddutyiface provides an interface to enable mocking the Amazon GuardDuty service client for testing your code. | 
| Package health provides the client and types for making API requests to AWS Health APIs and Notifications. | Package health provides the client and types for making API requests to AWS Health APIs and Notifications. | 
| 
          
            healthiface
            
            
          
           Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code. | Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code. | 
| Package iam provides the client and types for making API requests to AWS Identity and Access Management. | Package iam provides the client and types for making API requests to AWS Identity and Access Management. | 
| 
          
            iamiface
            
            
          
           Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code. | Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code. | 
| Package inspector provides the client and types for making API requests to Amazon Inspector. | Package inspector provides the client and types for making API requests to Amazon Inspector. | 
| 
          
            inspectoriface
            
            
          
           Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code. | Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code. | 
| Package iot provides the client and types for making API requests to AWS IoT. AWS IoT provides secure, bi-directional communication between Internet-connected things (such as sensors, actuators, embedded devices, or smart appliances) and the AWS cloud. | Package iot provides the client and types for making API requests to AWS IoT. AWS IoT provides secure, bi-directional communication between Internet-connected things (such as sensors, actuators, embedded devices, or smart appliances) and the AWS cloud. | 
| 
          
            iotiface
            
            
          
           Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code. | Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code. | 
| Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane. | Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane. | 
| 
          
            iotdataplaneiface
            
            
          
           Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code. | Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code. | 
| Package iotjobsdataplane provides the client and types for making API requests to AWS IoT Jobs Data Plane. | Package iotjobsdataplane provides the client and types for making API requests to AWS IoT Jobs Data Plane. | 
| 
          
            iotjobsdataplaneiface
            
            
          
           Package iotjobsdataplaneiface provides an interface to enable mocking the AWS IoT Jobs Data Plane service client for testing your code. | Package iotjobsdataplaneiface provides an interface to enable mocking the AWS IoT Jobs Data Plane service client for testing your code. | 
| Package kinesis provides the client and types for making API requests to Amazon Kinesis. | Package kinesis provides the client and types for making API requests to Amazon Kinesis. | 
| 
          
            kinesisiface
            
            
          
           Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code. | Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code. | 
| Package kinesisanalytics provides the client and types for making API requests to Amazon Kinesis Analytics. | Package kinesisanalytics provides the client and types for making API requests to Amazon Kinesis Analytics. | 
| 
          
            kinesisanalyticsiface
            
            
          
           Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code. | Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code. | 
| Package kinesisvideo provides the client and types for making API requests to Amazon Kinesis Video Streams. | Package kinesisvideo provides the client and types for making API requests to Amazon Kinesis Video Streams. | 
| 
          
            kinesisvideoiface
            
            
          
           Package kinesisvideoiface provides an interface to enable mocking the Amazon Kinesis Video Streams service client for testing your code. | Package kinesisvideoiface provides an interface to enable mocking the Amazon Kinesis Video Streams service client for testing your code. | 
| Package kinesisvideoarchivedmedia provides the client and types for making API requests to Amazon Kinesis Video Streams Archived Media. | Package kinesisvideoarchivedmedia provides the client and types for making API requests to Amazon Kinesis Video Streams Archived Media. | 
| 
          
            kinesisvideoarchivedmediaiface
            
            
          
           Package kinesisvideoarchivedmediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Archived Media service client for testing your code. | Package kinesisvideoarchivedmediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Archived Media service client for testing your code. | 
| Package kinesisvideomedia provides the client and types for making API requests to Amazon Kinesis Video Streams Media. | Package kinesisvideomedia provides the client and types for making API requests to Amazon Kinesis Video Streams Media. | 
| 
          
            kinesisvideomediaiface
            
            
          
           Package kinesisvideomediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Media service client for testing your code. | Package kinesisvideomediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Media service client for testing your code. | 
| Package kms provides the client and types for making API requests to AWS Key Management Service. | Package kms provides the client and types for making API requests to AWS Key Management Service. | 
| 
          
            kmsiface
            
            
          
           Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code. | Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code. | 
| Package lambda provides the client and types for making API requests to AWS Lambda. | Package lambda provides the client and types for making API requests to AWS Lambda. | 
| 
          
            lambdaiface
            
            
          
           Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code. | Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code. | 
| Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service. | Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service. | 
| 
          
            lexmodelbuildingserviceiface
            
            
          
           Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code. | Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code. | 
| Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service. | Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service. | 
| 
          
            lexruntimeserviceiface
            
            
          
           Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code. | Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code. | 
| Package lightsail provides the client and types for making API requests to Amazon Lightsail. | Package lightsail provides the client and types for making API requests to Amazon Lightsail. | 
| 
          
            lightsailiface
            
            
          
           Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code. | Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code. | 
| Package machinelearning provides the client and types for making API requests to Amazon Machine Learning. | Package machinelearning provides the client and types for making API requests to Amazon Machine Learning. | 
| 
          
            machinelearningiface
            
            
          
           Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code. | Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code. | 
| Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics. | Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics. | 
| 
          
            marketplacecommerceanalyticsiface
            
            
          
           Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code. | Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code. | 
| Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service. | Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service. | 
| 
          
            marketplaceentitlementserviceiface
            
            
          
           Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code. | Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code. | 
| Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering. | Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering. | 
| 
          
            marketplacemeteringiface
            
            
          
           Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code. | Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code. | 
| Package mediaconvert provides the client and types for making API requests to AWS Elemental MediaConvert. | Package mediaconvert provides the client and types for making API requests to AWS Elemental MediaConvert. | 
| 
          
            mediaconvertiface
            
            
          
           Package mediaconvertiface provides an interface to enable mocking the AWS Elemental MediaConvert service client for testing your code. | Package mediaconvertiface provides an interface to enable mocking the AWS Elemental MediaConvert service client for testing your code. | 
| Package medialive provides the client and types for making API requests to AWS Elemental MediaLive. | Package medialive provides the client and types for making API requests to AWS Elemental MediaLive. | 
| 
          
            medialiveiface
            
            
          
           Package medialiveiface provides an interface to enable mocking the AWS Elemental MediaLive service client for testing your code. | Package medialiveiface provides an interface to enable mocking the AWS Elemental MediaLive service client for testing your code. | 
| Package mediapackage provides the client and types for making API requests to AWS Elemental MediaPackage. | Package mediapackage provides the client and types for making API requests to AWS Elemental MediaPackage. | 
| 
          
            mediapackageiface
            
            
          
           Package mediapackageiface provides an interface to enable mocking the AWS Elemental MediaPackage service client for testing your code. | Package mediapackageiface provides an interface to enable mocking the AWS Elemental MediaPackage service client for testing your code. | 
| Package mediastore provides the client and types for making API requests to AWS Elemental MediaStore. | Package mediastore provides the client and types for making API requests to AWS Elemental MediaStore. | 
| 
          
            mediastoreiface
            
            
          
           Package mediastoreiface provides an interface to enable mocking the AWS Elemental MediaStore service client for testing your code. | Package mediastoreiface provides an interface to enable mocking the AWS Elemental MediaStore service client for testing your code. | 
| Package mediastoredata provides the client and types for making API requests to AWS Elemental MediaStore Data Plane. | Package mediastoredata provides the client and types for making API requests to AWS Elemental MediaStore Data Plane. | 
| 
          
            mediastoredataiface
            
            
          
           Package mediastoredataiface provides an interface to enable mocking the AWS Elemental MediaStore Data Plane service client for testing your code. | Package mediastoredataiface provides an interface to enable mocking the AWS Elemental MediaStore Data Plane service client for testing your code. | 
| Package migrationhub provides the client and types for making API requests to AWS Migration Hub. | Package migrationhub provides the client and types for making API requests to AWS Migration Hub. | 
| 
          
            migrationhubiface
            
            
          
           Package migrationhubiface provides an interface to enable mocking the AWS Migration Hub service client for testing your code. | Package migrationhubiface provides an interface to enable mocking the AWS Migration Hub service client for testing your code. | 
| Package mobile provides the client and types for making API requests to AWS Mobile. | Package mobile provides the client and types for making API requests to AWS Mobile. | 
| 
          
            mobileiface
            
            
          
           Package mobileiface provides an interface to enable mocking the AWS Mobile service client for testing your code. | Package mobileiface provides an interface to enable mocking the AWS Mobile service client for testing your code. | 
| Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics. | Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics. | 
| 
          
            mobileanalyticsiface
            
            
          
           Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code. | Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code. | 
| Package mq provides the client and types for making API requests to AmazonMQ. | Package mq provides the client and types for making API requests to AmazonMQ. | 
| 
          
            mqiface
            
            
          
           Package mqiface provides an interface to enable mocking the AmazonMQ service client for testing your code. | Package mqiface provides an interface to enable mocking the AmazonMQ service client for testing your code. | 
| Package mturk provides the client and types for making API requests to Amazon Mechanical Turk. | Package mturk provides the client and types for making API requests to Amazon Mechanical Turk. | 
| 
          
            mturkiface
            
            
          
           Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code. | Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code. | 
| Package opsworks provides the client and types for making API requests to AWS OpsWorks. | Package opsworks provides the client and types for making API requests to AWS OpsWorks. | 
| 
          
            opsworksiface
            
            
          
           Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code. | Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code. | 
| Package opsworkscm provides the client and types for making API requests to AWS OpsWorks for Chef Automate. | Package opsworkscm provides the client and types for making API requests to AWS OpsWorks for Chef Automate. | 
| 
          
            opsworkscmiface
            
            
          
           Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks for Chef Automate service client for testing your code. | Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks for Chef Automate service client for testing your code. | 
| Package organizations provides the client and types for making API requests to AWS Organizations. | Package organizations provides the client and types for making API requests to AWS Organizations. | 
| 
          
            organizationsiface
            
            
          
           Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code. | Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code. | 
| Package pinpoint provides the client and types for making API requests to Amazon Pinpoint. | Package pinpoint provides the client and types for making API requests to Amazon Pinpoint. | 
| 
          
            pinpointiface
            
            
          
           Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code. | Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code. | 
| Package polly provides the client and types for making API requests to Amazon Polly. | Package polly provides the client and types for making API requests to Amazon Polly. | 
| 
          
            pollyiface
            
            
          
           Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code. | Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code. | 
| Package pricing provides the client and types for making API requests to AWS Price List Service. | Package pricing provides the client and types for making API requests to AWS Price List Service. | 
| 
          
            pricingiface
            
            
          
           Package pricingiface provides an interface to enable mocking the AWS Price List Service service client for testing your code. | Package pricingiface provides an interface to enable mocking the AWS Price List Service service client for testing your code. | 
| Package rds provides the client and types for making API requests to Amazon Relational Database Service. | Package rds provides the client and types for making API requests to Amazon Relational Database Service. | 
| 
          
            rdsiface
            
            
          
           Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code. | Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code. | 
| Package redshift provides the client and types for making API requests to Amazon Redshift. | Package redshift provides the client and types for making API requests to Amazon Redshift. | 
| 
          
            redshiftiface
            
            
          
           Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code. | Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code. | 
| Package rekognition provides the client and types for making API requests to Amazon Rekognition. | Package rekognition provides the client and types for making API requests to Amazon Rekognition. | 
| 
          
            rekognitioniface
            
            
          
           Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code. | Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code. | 
| Package resourcegroups provides the client and types for making API requests to AWS Resource Groups. | Package resourcegroups provides the client and types for making API requests to AWS Resource Groups. | 
| 
          
            resourcegroupsiface
            
            
          
           Package resourcegroupsiface provides an interface to enable mocking the AWS Resource Groups service client for testing your code. | Package resourcegroupsiface provides an interface to enable mocking the AWS Resource Groups service client for testing your code. | 
| Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API. | Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API. | 
| 
          
            resourcegroupstaggingapiiface
            
            
          
           Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code. | Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code. | 
| Package route53 provides the client and types for making API requests to Amazon Route 53. | Package route53 provides the client and types for making API requests to Amazon Route 53. | 
| 
          
            route53iface
            
            
          
           Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code. | Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code. | 
| Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains. | Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains. | 
| 
          
            route53domainsiface
            
            
          
           Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code. | Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code. | 
| Package s3 provides the client and types for making API requests to Amazon Simple Storage Service. | Package s3 provides the client and types for making API requests to Amazon Simple Storage Service. | 
| 
          
            s3crypto
            
            
          
           Package s3crypto provides encryption to S3 using KMS and AES GCM. | Package s3crypto provides encryption to S3 using KMS and AES GCM. | 
| 
          
            s3iface
            
            
          
           Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code. | Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code. | 
| 
          
            s3manager
            
            
          
           Package s3manager provides utilities to upload and download objects from S3 concurrently. | Package s3manager provides utilities to upload and download objects from S3 concurrently. | 
| 
          
            s3manager/s3manageriface
            
            
          
           Package s3manageriface provides an interface for the s3manager package | Package s3manageriface provides an interface for the s3manager package | 
| Package sagemaker provides the client and types for making API requests to Amazon SageMaker Service. | Package sagemaker provides the client and types for making API requests to Amazon SageMaker Service. | 
| 
          
            sagemakeriface
            
            
          
           Package sagemakeriface provides an interface to enable mocking the Amazon SageMaker Service service client for testing your code. | Package sagemakeriface provides an interface to enable mocking the Amazon SageMaker Service service client for testing your code. | 
| Package sagemakerruntime provides the client and types for making API requests to Amazon SageMaker Runtime. | Package sagemakerruntime provides the client and types for making API requests to Amazon SageMaker Runtime. | 
| 
          
            sagemakerruntimeiface
            
            
          
           Package sagemakerruntimeiface provides an interface to enable mocking the Amazon SageMaker Runtime service client for testing your code. | Package sagemakerruntimeiface provides an interface to enable mocking the Amazon SageMaker Runtime service client for testing your code. | 
| Package serverlessapplicationrepository provides the client and types for making API requests to AWSServerlessApplicationRepository. | Package serverlessapplicationrepository provides the client and types for making API requests to AWSServerlessApplicationRepository. | 
| 
          
            serverlessapplicationrepositoryiface
            
            
          
           Package serverlessapplicationrepositoryiface provides an interface to enable mocking the AWSServerlessApplicationRepository service client for testing your code. | Package serverlessapplicationrepositoryiface provides an interface to enable mocking the AWSServerlessApplicationRepository service client for testing your code. | 
| Package servicecatalog provides the client and types for making API requests to AWS Service Catalog. | Package servicecatalog provides the client and types for making API requests to AWS Service Catalog. | 
| 
          
            servicecatalogiface
            
            
          
           Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code. | Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code. | 
| Package servicediscovery provides the client and types for making API requests to Amazon Route 53 Auto Naming. | Package servicediscovery provides the client and types for making API requests to Amazon Route 53 Auto Naming. | 
| 
          
            servicediscoveryiface
            
            
          
           Package servicediscoveryiface provides an interface to enable mocking the Amazon Route 53 Auto Naming service client for testing your code. | Package servicediscoveryiface provides an interface to enable mocking the Amazon Route 53 Auto Naming service client for testing your code. | 
| Package ses provides the client and types for making API requests to Amazon Simple Email Service. | Package ses provides the client and types for making API requests to Amazon Simple Email Service. | 
| 
          
            sesiface
            
            
          
           Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code. | Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code. | 
| Package sfn provides the client and types for making API requests to AWS Step Functions. | Package sfn provides the client and types for making API requests to AWS Step Functions. | 
| 
          
            sfniface
            
            
          
           Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code. | Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code. | 
| Package shield provides the client and types for making API requests to AWS Shield. | Package shield provides the client and types for making API requests to AWS Shield. | 
| 
          
            shieldiface
            
            
          
           Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code. | Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code. | 
| Package simpledb provides the client and types for making API requests to Amazon SimpleDB. | Package simpledb provides the client and types for making API requests to Amazon SimpleDB. | 
| 
          
            simpledbiface
            
            
          
           Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code. | Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code. | 
| Package sms provides the client and types for making API requests to AWS Server Migration Service. | Package sms provides the client and types for making API requests to AWS Server Migration Service. | 
| 
          
            smsiface
            
            
          
           Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code. | Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code. | 
| Package snowball provides the client and types for making API requests to Amazon Import/Export Snowball. | Package snowball provides the client and types for making API requests to Amazon Import/Export Snowball. | 
| 
          
            snowballiface
            
            
          
           Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code. | Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code. | 
| Package sns provides the client and types for making API requests to Amazon Simple Notification Service. | Package sns provides the client and types for making API requests to Amazon Simple Notification Service. | 
| 
          
            snsiface
            
            
          
           Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code. | Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code. | 
| Package sqs provides the client and types for making API requests to Amazon Simple Queue Service. | Package sqs provides the client and types for making API requests to Amazon Simple Queue Service. | 
| 
          
            sqsiface
            
            
          
           Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code. | Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code. | 
| Package ssm provides the client and types for making API requests to Amazon Simple Systems Manager (SSM). | Package ssm provides the client and types for making API requests to Amazon Simple Systems Manager (SSM). | 
| 
          
            ssmiface
            
            
          
           Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code. | Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code. | 
| Package storagegateway provides the client and types for making API requests to AWS Storage Gateway. | Package storagegateway provides the client and types for making API requests to AWS Storage Gateway. | 
| 
          
            storagegatewayiface
            
            
          
           Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code. | Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code. | 
| Package sts provides the client and types for making API requests to AWS Security Token Service. | Package sts provides the client and types for making API requests to AWS Security Token Service. | 
| 
          
            stsiface
            
            
          
           Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code. | Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code. | 
| Package support provides the client and types for making API requests to AWS Support. | Package support provides the client and types for making API requests to AWS Support. | 
| 
          
            supportiface
            
            
          
           Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code. | Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code. | 
| Package swf provides the client and types for making API requests to Amazon Simple Workflow Service. | Package swf provides the client and types for making API requests to Amazon Simple Workflow Service. | 
| 
          
            swfiface
            
            
          
           Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code. | Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code. | 
| Package translate provides the client and types for making API requests to Amazon Translate. | Package translate provides the client and types for making API requests to Amazon Translate. | 
| 
          
            translateiface
            
            
          
           Package translateiface provides an interface to enable mocking the Amazon Translate service client for testing your code. | Package translateiface provides an interface to enable mocking the Amazon Translate service client for testing your code. | 
| Package waf provides the client and types for making API requests to AWS WAF. | Package waf provides the client and types for making API requests to AWS WAF. | 
| 
          
            wafiface
            
            
          
           Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code. | Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code. | 
| Package wafregional provides the client and types for making API requests to AWS WAF Regional. | Package wafregional provides the client and types for making API requests to AWS WAF Regional. | 
| 
          
            wafregionaliface
            
            
          
           Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code. | Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code. | 
| Package workdocs provides the client and types for making API requests to Amazon WorkDocs. | Package workdocs provides the client and types for making API requests to Amazon WorkDocs. | 
| 
          
            workdocsiface
            
            
          
           Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code. | Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code. | 
| Package workspaces provides the client and types for making API requests to Amazon WorkSpaces. | Package workspaces provides the client and types for making API requests to Amazon WorkSpaces. | 
| 
          
            workspacesiface
            
            
          
           Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code. | Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code. | 
| Package xray provides the client and types for making API requests to AWS X-Ray. | Package xray provides the client and types for making API requests to AWS X-Ray. | 
| 
          
            xrayiface
            
            
          
           Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code. | Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code. | 
 Click to show internal directories. 
   Click to hide internal directories.