Directories
      ¶
    
    | Path | Synopsis | 
|---|---|
| 
       Package acm provides the client and types for making API requests to AWS Certificate Manager. 
         | 
      Package acm provides the client and types for making API requests to AWS Certificate Manager. | 
| 
         
          
            acmiface
            
            
          
           
      Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code. 
         | 
      Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code. | 
| 
       Package acmpca provides the client and types for making API requests to AWS Certificate Manager Private Certificate Authority. 
         | 
      Package acmpca provides the client and types for making API requests to AWS Certificate Manager Private Certificate Authority. | 
| 
         
          
            acmpcaiface
            
            
          
           
      Package acmpcaiface provides an interface to enable mocking the AWS Certificate Manager Private Certificate Authority service client for testing your code. 
         | 
      Package acmpcaiface provides an interface to enable mocking the AWS Certificate Manager Private Certificate Authority service client for testing your code. | 
| 
       Package alexaforbusiness provides the client and types for making API requests to Alexa For Business. 
         | 
      Package alexaforbusiness provides the client and types for making API requests to Alexa For Business. | 
| 
         
          
            alexaforbusinessiface
            
            
          
           
      Package alexaforbusinessiface provides an interface to enable mocking the Alexa For Business service client for testing your code. 
         | 
      Package alexaforbusinessiface provides an interface to enable mocking the Alexa For Business service client for testing your code. | 
| 
       Package apigateway provides the client and types for making API requests to Amazon API Gateway. 
         | 
      Package apigateway provides the client and types for making API requests to Amazon API Gateway. | 
| 
         
          
            apigatewayiface
            
            
          
           
      Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code. 
         | 
      Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code. | 
| 
       Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling. 
         | 
      Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling. | 
| 
         
          
            applicationautoscalingiface
            
            
          
           
      Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code. 
         | 
      Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code. | 
| 
       Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service. 
         | 
      Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service. | 
| 
         
          
            applicationdiscoveryserviceiface
            
            
          
           
      Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code. 
         | 
      Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code. | 
| 
       Package appstream provides the client and types for making API requests to Amazon AppStream. 
         | 
      Package appstream provides the client and types for making API requests to Amazon AppStream. | 
| 
         
          
            appstreamiface
            
            
          
           
      Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code. 
         | 
      Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code. | 
| 
       Package appsync provides the client and types for making API requests to AWS AppSync. 
         | 
      Package appsync provides the client and types for making API requests to AWS AppSync. | 
| 
         
          
            appsynciface
            
            
          
           
      Package appsynciface provides an interface to enable mocking the AWS AppSync service client for testing your code. 
         | 
      Package appsynciface provides an interface to enable mocking the AWS AppSync service client for testing your code. | 
| 
       Package athena provides the client and types for making API requests to Amazon Athena. 
         | 
      Package athena provides the client and types for making API requests to Amazon Athena. | 
| 
         
          
            athenaiface
            
            
          
           
      Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code. 
         | 
      Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code. | 
| 
       Package autoscaling provides the client and types for making API requests to Auto Scaling. 
         | 
      Package autoscaling provides the client and types for making API requests to Auto Scaling. | 
| 
         
          
            autoscalingiface
            
            
          
           
      Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code. 
         | 
      Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code. | 
| 
       Package autoscalingplans provides the client and types for making API requests to AWS Auto Scaling Plans. 
         | 
      Package autoscalingplans provides the client and types for making API requests to AWS Auto Scaling Plans. | 
| 
         
          
            autoscalingplansiface
            
            
          
           
      Package autoscalingplansiface provides an interface to enable mocking the AWS Auto Scaling Plans service client for testing your code. 
         | 
      Package autoscalingplansiface provides an interface to enable mocking the AWS Auto Scaling Plans service client for testing your code. | 
| 
       Package batch provides the client and types for making API requests to AWS Batch. 
         | 
      Package batch provides the client and types for making API requests to AWS Batch. | 
| 
         
          
            batchiface
            
            
          
           
      Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code. 
         | 
      Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code. | 
| 
       Package budgets provides the client and types for making API requests to AWS Budgets. 
         | 
      Package budgets provides the client and types for making API requests to AWS Budgets. | 
| 
         
          
            budgetsiface
            
            
          
           
      Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code. 
         | 
      Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code. | 
| 
       Package cloud9 provides the client and types for making API requests to AWS Cloud9. 
         | 
      Package cloud9 provides the client and types for making API requests to AWS Cloud9. | 
| 
         
          
            cloud9iface
            
            
          
           
      Package cloud9iface provides an interface to enable mocking the AWS Cloud9 service client for testing your code. 
         | 
      Package cloud9iface provides an interface to enable mocking the AWS Cloud9 service client for testing your code. | 
| 
       Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory. 
         | 
      Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory. | 
| 
         
          
            clouddirectoryiface
            
            
          
           
      Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code. 
         | 
      Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code. | 
| 
       Package cloudformation provides the client and types for making API requests to AWS CloudFormation. 
         | 
      Package cloudformation provides the client and types for making API requests to AWS CloudFormation. | 
| 
         
          
            cloudformationiface
            
            
          
           
      Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code. 
         | 
      Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code. | 
| 
       Package cloudfront provides the client and types for making API requests to Amazon CloudFront. 
         | 
      Package cloudfront provides the client and types for making API requests to Amazon CloudFront. | 
| 
         
          
            cloudfrontiface
            
            
          
           
      Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code. 
         | 
      Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code. | 
| 
         
          
            sign
            
            
          
           
      Package sign provides utilities to generate signed URLs for Amazon CloudFront. 
         | 
      Package sign provides utilities to generate signed URLs for Amazon CloudFront. | 
| 
       Package cloudhsm provides the client and types for making API requests to Amazon CloudHSM. 
         | 
      Package cloudhsm provides the client and types for making API requests to Amazon CloudHSM. | 
| 
         
          
            cloudhsmiface
            
            
          
           
      Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code. 
         | 
      Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code. | 
| 
       Package cloudhsmv2 provides the client and types for making API requests to AWS CloudHSM V2. 
         | 
      Package cloudhsmv2 provides the client and types for making API requests to AWS CloudHSM V2. | 
| 
         
          
            cloudhsmv2iface
            
            
          
           
      Package cloudhsmv2iface provides an interface to enable mocking the AWS CloudHSM V2 service client for testing your code. 
         | 
      Package cloudhsmv2iface provides an interface to enable mocking the AWS CloudHSM V2 service client for testing your code. | 
| 
       Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch. 
         | 
      Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch. | 
| 
         
          
            cloudsearchiface
            
            
          
           
      Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code. 
         | 
      Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code. | 
| 
       Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain. 
         | 
      Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain. | 
| 
         
          
            cloudsearchdomainiface
            
            
          
           
      Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code. 
         | 
      Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code. | 
| 
       Package cloudtrail provides the client and types for making API requests to AWS CloudTrail. 
         | 
      Package cloudtrail provides the client and types for making API requests to AWS CloudTrail. | 
| 
         
          
            cloudtrailiface
            
            
          
           
      Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code. 
         | 
      Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code. | 
| 
       Package cloudwatch provides the client and types for making API requests to Amazon CloudWatch. 
         | 
      Package cloudwatch provides the client and types for making API requests to Amazon CloudWatch. | 
| 
         
          
            cloudwatchiface
            
            
          
           
      Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code. 
         | 
      Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code. | 
| 
       Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events. 
         | 
      Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events. | 
| 
         
          
            cloudwatcheventsiface
            
            
          
           
      Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code. 
         | 
      Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code. | 
| 
       Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs. 
         | 
      Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs. | 
| 
         
          
            cloudwatchlogsiface
            
            
          
           
      Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code. 
         | 
      Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code. | 
| 
       Package codebuild provides the client and types for making API requests to AWS CodeBuild. 
         | 
      Package codebuild provides the client and types for making API requests to AWS CodeBuild. | 
| 
         
          
            codebuildiface
            
            
          
           
      Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code. 
         | 
      Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code. | 
| 
       Package codecommit provides the client and types for making API requests to AWS CodeCommit. 
         | 
      Package codecommit provides the client and types for making API requests to AWS CodeCommit. | 
| 
         
          
            codecommitiface
            
            
          
           
      Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code. 
         | 
      Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code. | 
| 
       Package codedeploy provides the client and types for making API requests to AWS CodeDeploy. 
         | 
      Package codedeploy provides the client and types for making API requests to AWS CodeDeploy. | 
| 
         
          
            codedeployiface
            
            
          
           
      Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code. 
         | 
      Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code. | 
| 
       Package codepipeline provides the client and types for making API requests to AWS CodePipeline. 
         | 
      Package codepipeline provides the client and types for making API requests to AWS CodePipeline. | 
| 
         
          
            codepipelineiface
            
            
          
           
      Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code. 
         | 
      Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code. | 
| 
       Package codestar provides the client and types for making API requests to AWS CodeStar. 
         | 
      Package codestar provides the client and types for making API requests to AWS CodeStar. | 
| 
         
          
            codestariface
            
            
          
           
      Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code. 
         | 
      Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code. | 
| 
       Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity. 
         | 
      Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity. | 
| 
         
          
            cognitoidentityiface
            
            
          
           
      Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code. 
         | 
      Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code. | 
| 
       Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider. 
         | 
      Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider. | 
| 
         
          
            cognitoidentityprovideriface
            
            
          
           
      Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code. 
         | 
      Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code. | 
| 
       Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync. 
         | 
      Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync. | 
| 
         
          
            cognitosynciface
            
            
          
           
      Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code. 
         | 
      Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code. | 
| 
       Package comprehend provides the client and types for making API requests to Amazon Comprehend. 
         | 
      Package comprehend provides the client and types for making API requests to Amazon Comprehend. | 
| 
         
          
            comprehendiface
            
            
          
           
      Package comprehendiface provides an interface to enable mocking the Amazon Comprehend service client for testing your code. 
         | 
      Package comprehendiface provides an interface to enable mocking the Amazon Comprehend service client for testing your code. | 
| 
       Package configservice provides the client and types for making API requests to AWS Config. 
         | 
      Package configservice provides the client and types for making API requests to AWS Config. | 
| 
         
          
            configserviceiface
            
            
          
           
      Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code. 
         | 
      Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code. | 
| 
       Package connect provides the client and types for making API requests to Amazon Connect Service. 
         | 
      Package connect provides the client and types for making API requests to Amazon Connect Service. | 
| 
         
          
            connectiface
            
            
          
           
      Package connectiface provides an interface to enable mocking the Amazon Connect Service service client for testing your code. 
         | 
      Package connectiface provides an interface to enable mocking the Amazon Connect Service service client for testing your code. | 
| 
       Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service. 
         | 
      Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service. | 
| 
         
          
            costandusagereportserviceiface
            
            
          
           
      Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code. 
         | 
      Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code. | 
| 
       Package costexplorer provides the client and types for making API requests to AWS Cost Explorer Service. 
         | 
      Package costexplorer provides the client and types for making API requests to AWS Cost Explorer Service. | 
| 
         
          
            costexploreriface
            
            
          
           
      Package costexploreriface provides an interface to enable mocking the AWS Cost Explorer Service service client for testing your code. 
         | 
      Package costexploreriface provides an interface to enable mocking the AWS Cost Explorer Service service client for testing your code. | 
| 
       Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service. 
         | 
      Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service. | 
| 
         
          
            databasemigrationserviceiface
            
            
          
           
      Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code. 
         | 
      Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code. | 
| 
       Package datapipeline provides the client and types for making API requests to AWS Data Pipeline. 
         | 
      Package datapipeline provides the client and types for making API requests to AWS Data Pipeline. | 
| 
         
          
            datapipelineiface
            
            
          
           
      Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code. 
         | 
      Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code. | 
| 
       Package dax provides the client and types for making API requests to Amazon DynamoDB Accelerator (DAX). 
         | 
      Package dax provides the client and types for making API requests to Amazon DynamoDB Accelerator (DAX). | 
| 
         
          
            daxiface
            
            
          
           
      Package daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code. 
         | 
      Package daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code. | 
| 
       Package devicefarm provides the client and types for making API requests to AWS Device Farm. 
         | 
      Package devicefarm provides the client and types for making API requests to AWS Device Farm. | 
| 
         
          
            devicefarmiface
            
            
          
           
      Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code. 
         | 
      Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code. | 
| 
       Package directconnect provides the client and types for making API requests to AWS Direct Connect. 
         | 
      Package directconnect provides the client and types for making API requests to AWS Direct Connect. | 
| 
         
          
            directconnectiface
            
            
          
           
      Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code. 
         | 
      Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code. | 
| 
       Package directoryservice provides the client and types for making API requests to AWS Directory Service. 
         | 
      Package directoryservice provides the client and types for making API requests to AWS Directory Service. | 
| 
         
          
            directoryserviceiface
            
            
          
           
      Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code. 
         | 
      Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code. | 
| 
       Package dynamodb provides the client and types for making API requests to Amazon DynamoDB. 
         | 
      Package dynamodb provides the client and types for making API requests to Amazon DynamoDB. | 
| 
         
          
            dynamodbattribute
            
            
          
           
      Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues. 
         | 
      Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues. | 
| 
         
          
            dynamodbiface
            
            
          
           
      Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code. 
         | 
      Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code. | 
| 
         
          
            expression
            
            
          
           
      Package expression provides types and functions to create Amazon DynamoDB Expression strings, ExpressionAttributeNames maps, and ExpressionAttributeValues maps. 
         | 
      Package expression provides types and functions to create Amazon DynamoDB Expression strings, ExpressionAttributeNames maps, and ExpressionAttributeValues maps. | 
| 
       Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams. 
         | 
      Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams. | 
| 
         
          
            dynamodbstreamsiface
            
            
          
           
      Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code. 
         | 
      Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code. | 
| 
       Package ec2 provides the client and types for making API requests to Amazon Elastic Compute Cloud. 
         | 
      Package ec2 provides the client and types for making API requests to Amazon Elastic Compute Cloud. | 
| 
         
          
            ec2iface
            
            
          
           
      Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code. 
         | 
      Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code. | 
| 
       Package ecr provides the client and types for making API requests to Amazon EC2 Container Registry. 
         | 
      Package ecr provides the client and types for making API requests to Amazon EC2 Container Registry. | 
| 
         
          
            ecriface
            
            
          
           
      Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code. 
         | 
      Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code. | 
| 
       Package ecs provides the client and types for making API requests to Amazon EC2 Container Service. 
         | 
      Package ecs provides the client and types for making API requests to Amazon EC2 Container Service. | 
| 
         
          
            ecsiface
            
            
          
           
      Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code. 
         | 
      Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code. | 
| 
       Package efs provides the client and types for making API requests to Amazon Elastic File System. 
         | 
      Package efs provides the client and types for making API requests to Amazon Elastic File System. | 
| 
         
          
            efsiface
            
            
          
           
      Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code. 
         | 
      Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code. | 
| 
       Package elasticache provides the client and types for making API requests to Amazon ElastiCache. 
         | 
      Package elasticache provides the client and types for making API requests to Amazon ElastiCache. | 
| 
         
          
            elasticacheiface
            
            
          
           
      Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code. 
         | 
      Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code. | 
| 
       Package elasticbeanstalk provides the client and types for making API requests to AWS Elastic Beanstalk. 
         | 
      Package elasticbeanstalk provides the client and types for making API requests to AWS Elastic Beanstalk. | 
| 
         
          
            elasticbeanstalkiface
            
            
          
           
      Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code. 
         | 
      Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code. | 
| 
       Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service. 
         | 
      Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service. | 
| 
         
          
            elasticsearchserviceiface
            
            
          
           
      Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code. 
         | 
      Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code. | 
| 
       Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder. 
         | 
      Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder. | 
| 
         
          
            elastictranscoderiface
            
            
          
           
      Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code. 
         | 
      Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code. | 
| 
       Package elb provides the client and types for making API requests to Elastic Load Balancing. 
         | 
      Package elb provides the client and types for making API requests to Elastic Load Balancing. | 
| 
         
          
            elbiface
            
            
          
           
      Package elbiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code. 
         | 
      Package elbiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code. | 
| 
       Package elbv2 provides the client and types for making API requests to Elastic Load Balancing. 
         | 
      Package elbv2 provides the client and types for making API requests to Elastic Load Balancing. | 
| 
         
          
            elbv2iface
            
            
          
           
      Package elbv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code. 
         | 
      Package elbv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code. | 
| 
       Package emr provides the client and types for making API requests to Amazon Elastic MapReduce. 
         | 
      Package emr provides the client and types for making API requests to Amazon Elastic MapReduce. | 
| 
         
          
            emriface
            
            
          
           
      Package emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code. 
         | 
      Package emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code. | 
| 
       Package firehose provides the client and types for making API requests to Amazon Kinesis Firehose. 
         | 
      Package firehose provides the client and types for making API requests to Amazon Kinesis Firehose. | 
| 
         
          
            firehoseiface
            
            
          
           
      Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code. 
         | 
      Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code. | 
| 
       Package fms provides the client and types for making API requests to Firewall Management Service. 
         | 
      Package fms provides the client and types for making API requests to Firewall Management Service. | 
| 
         
          
            fmsiface
            
            
          
           
      Package fmsiface provides an interface to enable mocking the Firewall Management Service service client for testing your code. 
         | 
      Package fmsiface provides an interface to enable mocking the Firewall Management Service service client for testing your code. | 
| 
       Package gamelift provides the client and types for making API requests to Amazon GameLift. 
         | 
      Package gamelift provides the client and types for making API requests to Amazon GameLift. | 
| 
         
          
            gameliftiface
            
            
          
           
      Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code. 
         | 
      Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code. | 
| 
       Package glacier provides the client and types for making API requests to Amazon Glacier. 
         | 
      Package glacier provides the client and types for making API requests to Amazon Glacier. | 
| 
         
          
            glacieriface
            
            
          
           
      Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code. 
         | 
      Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code. | 
| 
       Package glue provides the client and types for making API requests to AWS Glue. 
         | 
      Package glue provides the client and types for making API requests to AWS Glue. | 
| 
         
          
            glueiface
            
            
          
           
      Package glueiface provides an interface to enable mocking the AWS Glue service client for testing your code. 
         | 
      Package glueiface provides an interface to enable mocking the AWS Glue service client for testing your code. | 
| 
       Package greengrass provides the client and types for making API requests to AWS Greengrass. 
         | 
      Package greengrass provides the client and types for making API requests to AWS Greengrass. | 
| 
         
          
            greengrassiface
            
            
          
           
      Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code. 
         | 
      Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code. | 
| 
       Package guardduty provides the client and types for making API requests to Amazon GuardDuty. 
         | 
      Package guardduty provides the client and types for making API requests to Amazon GuardDuty. | 
| 
         
          
            guarddutyiface
            
            
          
           
      Package guarddutyiface provides an interface to enable mocking the Amazon GuardDuty service client for testing your code. 
         | 
      Package guarddutyiface provides an interface to enable mocking the Amazon GuardDuty service client for testing your code. | 
| 
       Package health provides the client and types for making API requests to AWS Health APIs and Notifications. 
         | 
      Package health provides the client and types for making API requests to AWS Health APIs and Notifications. | 
| 
         
          
            healthiface
            
            
          
           
      Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code. 
         | 
      Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code. | 
| 
       Package iam provides the client and types for making API requests to AWS Identity and Access Management. 
         | 
      Package iam provides the client and types for making API requests to AWS Identity and Access Management. | 
| 
         
          
            iamiface
            
            
          
           
      Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code. 
         | 
      Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code. | 
| 
       Package inspector provides the client and types for making API requests to Amazon Inspector. 
         | 
      Package inspector provides the client and types for making API requests to Amazon Inspector. | 
| 
         
          
            inspectoriface
            
            
          
           
      Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code. 
         | 
      Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code. | 
| 
       Package iot provides the client and types for making API requests to AWS IoT. AWS IoT provides secure, bi-directional communication between Internet-connected things (such as sensors, actuators, embedded devices, or smart appliances) and the AWS cloud. 
         | 
      Package iot provides the client and types for making API requests to AWS IoT. AWS IoT provides secure, bi-directional communication between Internet-connected things (such as sensors, actuators, embedded devices, or smart appliances) and the AWS cloud. | 
| 
         
          
            iotiface
            
            
          
           
      Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code. 
         | 
      Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code. | 
| 
       Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane. 
         | 
      Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane. | 
| 
         
          
            iotdataplaneiface
            
            
          
           
      Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code. 
         | 
      Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code. | 
| 
       Package iotjobsdataplane provides the client and types for making API requests to AWS IoT Jobs Data Plane. 
         | 
      Package iotjobsdataplane provides the client and types for making API requests to AWS IoT Jobs Data Plane. | 
| 
         
          
            iotjobsdataplaneiface
            
            
          
           
      Package iotjobsdataplaneiface provides an interface to enable mocking the AWS IoT Jobs Data Plane service client for testing your code. 
         | 
      Package iotjobsdataplaneiface provides an interface to enable mocking the AWS IoT Jobs Data Plane service client for testing your code. | 
| 
       Package kinesis provides the client and types for making API requests to Amazon Kinesis. 
         | 
      Package kinesis provides the client and types for making API requests to Amazon Kinesis. | 
| 
         
          
            kinesisiface
            
            
          
           
      Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code. 
         | 
      Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code. | 
| 
       Package kinesisanalytics provides the client and types for making API requests to Amazon Kinesis Analytics. 
         | 
      Package kinesisanalytics provides the client and types for making API requests to Amazon Kinesis Analytics. | 
| 
         
          
            kinesisanalyticsiface
            
            
          
           
      Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code. 
         | 
      Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code. | 
| 
       Package kinesisvideo provides the client and types for making API requests to Amazon Kinesis Video Streams. 
         | 
      Package kinesisvideo provides the client and types for making API requests to Amazon Kinesis Video Streams. | 
| 
         
          
            kinesisvideoiface
            
            
          
           
      Package kinesisvideoiface provides an interface to enable mocking the Amazon Kinesis Video Streams service client for testing your code. 
         | 
      Package kinesisvideoiface provides an interface to enable mocking the Amazon Kinesis Video Streams service client for testing your code. | 
| 
       Package kinesisvideoarchivedmedia provides the client and types for making API requests to Amazon Kinesis Video Streams Archived Media. 
         | 
      Package kinesisvideoarchivedmedia provides the client and types for making API requests to Amazon Kinesis Video Streams Archived Media. | 
| 
         
          
            kinesisvideoarchivedmediaiface
            
            
          
           
      Package kinesisvideoarchivedmediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Archived Media service client for testing your code. 
         | 
      Package kinesisvideoarchivedmediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Archived Media service client for testing your code. | 
| 
       Package kinesisvideomedia provides the client and types for making API requests to Amazon Kinesis Video Streams Media. 
         | 
      Package kinesisvideomedia provides the client and types for making API requests to Amazon Kinesis Video Streams Media. | 
| 
         
          
            kinesisvideomediaiface
            
            
          
           
      Package kinesisvideomediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Media service client for testing your code. 
         | 
      Package kinesisvideomediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Media service client for testing your code. | 
| 
       Package kms provides the client and types for making API requests to AWS Key Management Service. 
         | 
      Package kms provides the client and types for making API requests to AWS Key Management Service. | 
| 
         
          
            kmsiface
            
            
          
           
      Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code. 
         | 
      Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code. | 
| 
       Package lambda provides the client and types for making API requests to AWS Lambda. 
         | 
      Package lambda provides the client and types for making API requests to AWS Lambda. | 
| 
         
          
            lambdaiface
            
            
          
           
      Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code. 
         | 
      Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code. | 
| 
       Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service. 
         | 
      Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service. | 
| 
         
          
            lexmodelbuildingserviceiface
            
            
          
           
      Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code. 
         | 
      Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code. | 
| 
       Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service. 
         | 
      Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service. | 
| 
         
          
            lexruntimeserviceiface
            
            
          
           
      Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code. 
         | 
      Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code. | 
| 
       Package lightsail provides the client and types for making API requests to Amazon Lightsail. 
         | 
      Package lightsail provides the client and types for making API requests to Amazon Lightsail. | 
| 
         
          
            lightsailiface
            
            
          
           
      Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code. 
         | 
      Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code. | 
| 
       Package machinelearning provides the client and types for making API requests to Amazon Machine Learning. 
         | 
      Package machinelearning provides the client and types for making API requests to Amazon Machine Learning. | 
| 
         
          
            machinelearningiface
            
            
          
           
      Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code. 
         | 
      Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code. | 
| 
       Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics. 
         | 
      Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics. | 
| 
         
          
            marketplacecommerceanalyticsiface
            
            
          
           
      Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code. 
         | 
      Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code. | 
| 
       Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service. 
         | 
      Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service. | 
| 
         
          
            marketplaceentitlementserviceiface
            
            
          
           
      Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code. 
         | 
      Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code. | 
| 
       Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering. 
         | 
      Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering. | 
| 
         
          
            marketplacemeteringiface
            
            
          
           
      Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code. 
         | 
      Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code. | 
| 
       Package mediaconvert provides the client and types for making API requests to AWS Elemental MediaConvert. 
         | 
      Package mediaconvert provides the client and types for making API requests to AWS Elemental MediaConvert. | 
| 
         
          
            mediaconvertiface
            
            
          
           
      Package mediaconvertiface provides an interface to enable mocking the AWS Elemental MediaConvert service client for testing your code. 
         | 
      Package mediaconvertiface provides an interface to enable mocking the AWS Elemental MediaConvert service client for testing your code. | 
| 
       Package medialive provides the client and types for making API requests to AWS Elemental MediaLive. 
         | 
      Package medialive provides the client and types for making API requests to AWS Elemental MediaLive. | 
| 
         
          
            medialiveiface
            
            
          
           
      Package medialiveiface provides an interface to enable mocking the AWS Elemental MediaLive service client for testing your code. 
         | 
      Package medialiveiface provides an interface to enable mocking the AWS Elemental MediaLive service client for testing your code. | 
| 
       Package mediapackage provides the client and types for making API requests to AWS Elemental MediaPackage. 
         | 
      Package mediapackage provides the client and types for making API requests to AWS Elemental MediaPackage. | 
| 
         
          
            mediapackageiface
            
            
          
           
      Package mediapackageiface provides an interface to enable mocking the AWS Elemental MediaPackage service client for testing your code. 
         | 
      Package mediapackageiface provides an interface to enable mocking the AWS Elemental MediaPackage service client for testing your code. | 
| 
       Package mediastore provides the client and types for making API requests to AWS Elemental MediaStore. 
         | 
      Package mediastore provides the client and types for making API requests to AWS Elemental MediaStore. | 
| 
         
          
            mediastoreiface
            
            
          
           
      Package mediastoreiface provides an interface to enable mocking the AWS Elemental MediaStore service client for testing your code. 
         | 
      Package mediastoreiface provides an interface to enable mocking the AWS Elemental MediaStore service client for testing your code. | 
| 
       Package mediastoredata provides the client and types for making API requests to AWS Elemental MediaStore Data Plane. 
         | 
      Package mediastoredata provides the client and types for making API requests to AWS Elemental MediaStore Data Plane. | 
| 
         
          
            mediastoredataiface
            
            
          
           
      Package mediastoredataiface provides an interface to enable mocking the AWS Elemental MediaStore Data Plane service client for testing your code. 
         | 
      Package mediastoredataiface provides an interface to enable mocking the AWS Elemental MediaStore Data Plane service client for testing your code. | 
| 
       Package migrationhub provides the client and types for making API requests to AWS Migration Hub. 
         | 
      Package migrationhub provides the client and types for making API requests to AWS Migration Hub. | 
| 
         
          
            migrationhubiface
            
            
          
           
      Package migrationhubiface provides an interface to enable mocking the AWS Migration Hub service client for testing your code. 
         | 
      Package migrationhubiface provides an interface to enable mocking the AWS Migration Hub service client for testing your code. | 
| 
       Package mobile provides the client and types for making API requests to AWS Mobile. 
         | 
      Package mobile provides the client and types for making API requests to AWS Mobile. | 
| 
         
          
            mobileiface
            
            
          
           
      Package mobileiface provides an interface to enable mocking the AWS Mobile service client for testing your code. 
         | 
      Package mobileiface provides an interface to enable mocking the AWS Mobile service client for testing your code. | 
| 
       Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics. 
         | 
      Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics. | 
| 
         
          
            mobileanalyticsiface
            
            
          
           
      Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code. 
         | 
      Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code. | 
| 
       Package mq provides the client and types for making API requests to AmazonMQ. 
         | 
      Package mq provides the client and types for making API requests to AmazonMQ. | 
| 
         
          
            mqiface
            
            
          
           
      Package mqiface provides an interface to enable mocking the AmazonMQ service client for testing your code. 
         | 
      Package mqiface provides an interface to enable mocking the AmazonMQ service client for testing your code. | 
| 
       Package mturk provides the client and types for making API requests to Amazon Mechanical Turk. 
         | 
      Package mturk provides the client and types for making API requests to Amazon Mechanical Turk. | 
| 
         
          
            mturkiface
            
            
          
           
      Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code. 
         | 
      Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code. | 
| 
       Package opsworks provides the client and types for making API requests to AWS OpsWorks. 
         | 
      Package opsworks provides the client and types for making API requests to AWS OpsWorks. | 
| 
         
          
            opsworksiface
            
            
          
           
      Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code. 
         | 
      Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code. | 
| 
       Package opsworkscm provides the client and types for making API requests to AWS OpsWorks for Chef Automate. 
         | 
      Package opsworkscm provides the client and types for making API requests to AWS OpsWorks for Chef Automate. | 
| 
         
          
            opsworkscmiface
            
            
          
           
      Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks for Chef Automate service client for testing your code. 
         | 
      Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks for Chef Automate service client for testing your code. | 
| 
       Package organizations provides the client and types for making API requests to AWS Organizations. 
         | 
      Package organizations provides the client and types for making API requests to AWS Organizations. | 
| 
         
          
            organizationsiface
            
            
          
           
      Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code. 
         | 
      Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code. | 
| 
       Package pinpoint provides the client and types for making API requests to Amazon Pinpoint. 
         | 
      Package pinpoint provides the client and types for making API requests to Amazon Pinpoint. | 
| 
         
          
            pinpointiface
            
            
          
           
      Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code. 
         | 
      Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code. | 
| 
       Package polly provides the client and types for making API requests to Amazon Polly. 
         | 
      Package polly provides the client and types for making API requests to Amazon Polly. | 
| 
         
          
            pollyiface
            
            
          
           
      Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code. 
         | 
      Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code. | 
| 
       Package pricing provides the client and types for making API requests to AWS Price List Service. 
         | 
      Package pricing provides the client and types for making API requests to AWS Price List Service. | 
| 
         
          
            pricingiface
            
            
          
           
      Package pricingiface provides an interface to enable mocking the AWS Price List Service service client for testing your code. 
         | 
      Package pricingiface provides an interface to enable mocking the AWS Price List Service service client for testing your code. | 
| 
       Package rds provides the client and types for making API requests to Amazon Relational Database Service. 
         | 
      Package rds provides the client and types for making API requests to Amazon Relational Database Service. | 
| 
         
          
            rdsiface
            
            
          
           
      Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code. 
         | 
      Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code. | 
| 
       Package redshift provides the client and types for making API requests to Amazon Redshift. 
         | 
      Package redshift provides the client and types for making API requests to Amazon Redshift. | 
| 
         
          
            redshiftiface
            
            
          
           
      Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code. 
         | 
      Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code. | 
| 
       Package rekognition provides the client and types for making API requests to Amazon Rekognition. 
         | 
      Package rekognition provides the client and types for making API requests to Amazon Rekognition. | 
| 
         
          
            rekognitioniface
            
            
          
           
      Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code. 
         | 
      Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code. | 
| 
       Package resourcegroups provides the client and types for making API requests to AWS Resource Groups. 
         | 
      Package resourcegroups provides the client and types for making API requests to AWS Resource Groups. | 
| 
         
          
            resourcegroupsiface
            
            
          
           
      Package resourcegroupsiface provides an interface to enable mocking the AWS Resource Groups service client for testing your code. 
         | 
      Package resourcegroupsiface provides an interface to enable mocking the AWS Resource Groups service client for testing your code. | 
| 
       Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API. 
         | 
      Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API. | 
| 
         
          
            resourcegroupstaggingapiiface
            
            
          
           
      Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code. 
         | 
      Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code. | 
| 
       Package route53 provides the client and types for making API requests to Amazon Route 53. 
         | 
      Package route53 provides the client and types for making API requests to Amazon Route 53. | 
| 
         
          
            route53iface
            
            
          
           
      Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code. 
         | 
      Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code. | 
| 
       Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains. 
         | 
      Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains. | 
| 
         
          
            route53domainsiface
            
            
          
           
      Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code. 
         | 
      Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code. | 
| 
       Package s3 provides the client and types for making API requests to Amazon Simple Storage Service. 
         | 
      Package s3 provides the client and types for making API requests to Amazon Simple Storage Service. | 
| 
         
          
            s3crypto
            
            
          
           
      Package s3crypto provides encryption to S3 using KMS and AES GCM. 
         | 
      Package s3crypto provides encryption to S3 using KMS and AES GCM. | 
| 
         
          
            s3iface
            
            
          
           
      Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code. 
         | 
      Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code. | 
| 
         
          
            s3manager
            
            
          
           
      Package s3manager provides utilities to upload and download objects from S3 concurrently. 
         | 
      Package s3manager provides utilities to upload and download objects from S3 concurrently. | 
| 
         
          
            s3manager/s3manageriface
            
            
          
           
      Package s3manageriface provides an interface for the s3manager package 
         | 
      Package s3manageriface provides an interface for the s3manager package | 
| 
       Package sagemaker provides the client and types for making API requests to Amazon SageMaker Service. 
         | 
      Package sagemaker provides the client and types for making API requests to Amazon SageMaker Service. | 
| 
         
          
            sagemakeriface
            
            
          
           
      Package sagemakeriface provides an interface to enable mocking the Amazon SageMaker Service service client for testing your code. 
         | 
      Package sagemakeriface provides an interface to enable mocking the Amazon SageMaker Service service client for testing your code. | 
| 
       Package sagemakerruntime provides the client and types for making API requests to Amazon SageMaker Runtime. 
         | 
      Package sagemakerruntime provides the client and types for making API requests to Amazon SageMaker Runtime. | 
| 
         
          
            sagemakerruntimeiface
            
            
          
           
      Package sagemakerruntimeiface provides an interface to enable mocking the Amazon SageMaker Runtime service client for testing your code. 
         | 
      Package sagemakerruntimeiface provides an interface to enable mocking the Amazon SageMaker Runtime service client for testing your code. | 
| 
       Package secretsmanager provides the client and types for making API requests to AWS Secrets Manager. 
         | 
      Package secretsmanager provides the client and types for making API requests to AWS Secrets Manager. | 
| 
         
          
            secretsmanageriface
            
            
          
           
      Package secretsmanageriface provides an interface to enable mocking the AWS Secrets Manager service client for testing your code. 
         | 
      Package secretsmanageriface provides an interface to enable mocking the AWS Secrets Manager service client for testing your code. | 
| 
       Package serverlessapplicationrepository provides the client and types for making API requests to AWSServerlessApplicationRepository. 
         | 
      Package serverlessapplicationrepository provides the client and types for making API requests to AWSServerlessApplicationRepository. | 
| 
         
          
            serverlessapplicationrepositoryiface
            
            
          
           
      Package serverlessapplicationrepositoryiface provides an interface to enable mocking the AWSServerlessApplicationRepository service client for testing your code. 
         | 
      Package serverlessapplicationrepositoryiface provides an interface to enable mocking the AWSServerlessApplicationRepository service client for testing your code. | 
| 
       Package servicecatalog provides the client and types for making API requests to AWS Service Catalog. 
         | 
      Package servicecatalog provides the client and types for making API requests to AWS Service Catalog. | 
| 
         
          
            servicecatalogiface
            
            
          
           
      Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code. 
         | 
      Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code. | 
| 
       Package servicediscovery provides the client and types for making API requests to Amazon Route 53 Auto Naming. 
         | 
      Package servicediscovery provides the client and types for making API requests to Amazon Route 53 Auto Naming. | 
| 
         
          
            servicediscoveryiface
            
            
          
           
      Package servicediscoveryiface provides an interface to enable mocking the Amazon Route 53 Auto Naming service client for testing your code. 
         | 
      Package servicediscoveryiface provides an interface to enable mocking the Amazon Route 53 Auto Naming service client for testing your code. | 
| 
       Package ses provides the client and types for making API requests to Amazon Simple Email Service. 
         | 
      Package ses provides the client and types for making API requests to Amazon Simple Email Service. | 
| 
         
          
            sesiface
            
            
          
           
      Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code. 
         | 
      Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code. | 
| 
       Package sfn provides the client and types for making API requests to AWS Step Functions. 
         | 
      Package sfn provides the client and types for making API requests to AWS Step Functions. | 
| 
         
          
            sfniface
            
            
          
           
      Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code. 
         | 
      Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code. | 
| 
       Package shield provides the client and types for making API requests to AWS Shield. 
         | 
      Package shield provides the client and types for making API requests to AWS Shield. | 
| 
         
          
            shieldiface
            
            
          
           
      Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code. 
         | 
      Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code. | 
| 
       Package simpledb provides the client and types for making API requests to Amazon SimpleDB. 
         | 
      Package simpledb provides the client and types for making API requests to Amazon SimpleDB. | 
| 
         
          
            simpledbiface
            
            
          
           
      Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code. 
         | 
      Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code. | 
| 
       Package sms provides the client and types for making API requests to AWS Server Migration Service. 
         | 
      Package sms provides the client and types for making API requests to AWS Server Migration Service. | 
| 
         
          
            smsiface
            
            
          
           
      Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code. 
         | 
      Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code. | 
| 
       Package snowball provides the client and types for making API requests to Amazon Import/Export Snowball. 
         | 
      Package snowball provides the client and types for making API requests to Amazon Import/Export Snowball. | 
| 
         
          
            snowballiface
            
            
          
           
      Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code. 
         | 
      Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code. | 
| 
       Package sns provides the client and types for making API requests to Amazon Simple Notification Service. 
         | 
      Package sns provides the client and types for making API requests to Amazon Simple Notification Service. | 
| 
         
          
            snsiface
            
            
          
           
      Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code. 
         | 
      Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code. | 
| 
       Package sqs provides the client and types for making API requests to Amazon Simple Queue Service. 
         | 
      Package sqs provides the client and types for making API requests to Amazon Simple Queue Service. | 
| 
         
          
            sqsiface
            
            
          
           
      Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code. 
         | 
      Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code. | 
| 
       Package ssm provides the client and types for making API requests to Amazon Simple Systems Manager (SSM). 
         | 
      Package ssm provides the client and types for making API requests to Amazon Simple Systems Manager (SSM). | 
| 
         
          
            ssmiface
            
            
          
           
      Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code. 
         | 
      Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code. | 
| 
       Package storagegateway provides the client and types for making API requests to AWS Storage Gateway. 
         | 
      Package storagegateway provides the client and types for making API requests to AWS Storage Gateway. | 
| 
         
          
            storagegatewayiface
            
            
          
           
      Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code. 
         | 
      Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code. | 
| 
       Package sts provides the client and types for making API requests to AWS Security Token Service. 
         | 
      Package sts provides the client and types for making API requests to AWS Security Token Service. | 
| 
         
          
            stsiface
            
            
          
           
      Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code. 
         | 
      Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code. | 
| 
       Package support provides the client and types for making API requests to AWS Support. 
         | 
      Package support provides the client and types for making API requests to AWS Support. | 
| 
         
          
            supportiface
            
            
          
           
      Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code. 
         | 
      Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code. | 
| 
       Package swf provides the client and types for making API requests to Amazon Simple Workflow Service. 
         | 
      Package swf provides the client and types for making API requests to Amazon Simple Workflow Service. | 
| 
         
          
            swfiface
            
            
          
           
      Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code. 
         | 
      Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code. | 
| 
       Package transcribeservice provides the client and types for making API requests to Amazon Transcribe Service. 
         | 
      Package transcribeservice provides the client and types for making API requests to Amazon Transcribe Service. | 
| 
         
          
            transcribeserviceiface
            
            
          
           
      Package transcribeserviceiface provides an interface to enable mocking the Amazon Transcribe Service service client for testing your code. 
         | 
      Package transcribeserviceiface provides an interface to enable mocking the Amazon Transcribe Service service client for testing your code. | 
| 
       Package translate provides the client and types for making API requests to Amazon Translate. 
         | 
      Package translate provides the client and types for making API requests to Amazon Translate. | 
| 
         
          
            translateiface
            
            
          
           
      Package translateiface provides an interface to enable mocking the Amazon Translate service client for testing your code. 
         | 
      Package translateiface provides an interface to enable mocking the Amazon Translate service client for testing your code. | 
| 
       Package waf provides the client and types for making API requests to AWS WAF. 
         | 
      Package waf provides the client and types for making API requests to AWS WAF. | 
| 
         
          
            wafiface
            
            
          
           
      Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code. 
         | 
      Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code. | 
| 
       Package wafregional provides the client and types for making API requests to AWS WAF Regional. 
         | 
      Package wafregional provides the client and types for making API requests to AWS WAF Regional. | 
| 
         
          
            wafregionaliface
            
            
          
           
      Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code. 
         | 
      Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code. | 
| 
       Package workdocs provides the client and types for making API requests to Amazon WorkDocs. 
         | 
      Package workdocs provides the client and types for making API requests to Amazon WorkDocs. | 
| 
         
          
            workdocsiface
            
            
          
           
      Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code. 
         | 
      Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code. | 
| 
       Package workmail provides the client and types for making API requests to Amazon WorkMail. 
         | 
      Package workmail provides the client and types for making API requests to Amazon WorkMail. | 
| 
         
          
            workmailiface
            
            
          
           
      Package workmailiface provides an interface to enable mocking the Amazon WorkMail service client for testing your code. 
         | 
      Package workmailiface provides an interface to enable mocking the Amazon WorkMail service client for testing your code. | 
| 
       Package workspaces provides the client and types for making API requests to Amazon WorkSpaces. 
         | 
      Package workspaces provides the client and types for making API requests to Amazon WorkSpaces. | 
| 
         
          
            workspacesiface
            
            
          
           
      Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code. 
         | 
      Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code. | 
| 
       Package xray provides the client and types for making API requests to AWS X-Ray. 
         | 
      Package xray provides the client and types for making API requests to AWS X-Ray. | 
| 
         
          
            xrayiface
            
            
          
           
      Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code. 
         | 
      Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code. | 
 Click to show internal directories. 
   Click to hide internal directories.