 Documentation
      ¶
      Documentation
      ¶
    
    
  
    
  
    Overview ¶
Package sdk is the official AWS SDK for the Go programming language.
The AWS SDK for Go provides APIs and utilities that developers can use to build Go applications that use AWS services, such as Amazon Elastic Compute Cloud (Amazon EC2) and Amazon Simple Storage Service (Amazon S3).
The SDK removes the complexity of coding directly against a web service interface. It hides a lot of the lower-level plumbing, such as authentication, request retries, and error handling.
The SDK also includes helpful utilities on top of the AWS APIs that add additional capabilities and functionality. For example, the Amazon S3 Download and Upload Manager will automatically split up large objects into multiple parts and transfer them concurrently.
See the s3manager package documentation for more information. https://docs.aws.amazon.com/sdk-for-go/api/service/s3/s3manager/
Getting More Information ¶
Checkout the Getting Started Guide and API Reference Docs detailed the SDK's components and details on each AWS client the SDK supports.
The Getting Started Guide provides examples and detailed description of how to get setup with the SDK. https://docs.aws.amazon.com/sdk-for-go/v1/developer-guide/welcome.html
The API Reference Docs include a detailed breakdown of the SDK's components such as utilities and AWS clients. Use this as a reference of the Go types included with the SDK, such as AWS clients, API operations, and API parameters. https://docs.aws.amazon.com/sdk-for-go/api/
Overview of SDK's Packages ¶
The SDK is composed of two main components, SDK core, and service clients. The SDK core packages are all available under the aws package at the root of the SDK. Each client for a supported AWS service is available within its own package under the service folder at the root of the SDK.
- aws - SDK core, provides common shared types such as Config, Logger, and utilities to make working with API parameters easier. 
- awserr - Provides the error interface that the SDK will use for all errors that occur in the SDK's processing. This includes service API response errors as well. The Error type is made up of a code and message. Cast the SDK's returned error type to awserr.Error and call the Code method to compare returned error to specific error codes. See the package's documentation for additional values that can be extracted such as RequestId. 
- credentials - Provides the types and built in credentials providers the SDK will use to retrieve AWS credentials to make API requests with. Nested under this folder are also additional credentials providers such as stscreds for assuming IAM roles, and ec2rolecreds for EC2 Instance roles. 
- endpoints - Provides the AWS Regions and Endpoints metadata for the SDK. Use this to lookup AWS service endpoint information such as which services are in a region, and what regions a service is in. Constants are also provided for all region identifiers, e.g UsWest2RegionID for "us-west-2". 
- session - Provides initial default configuration, and load configuration from external sources such as environment and shared credentials file. 
- request - Provides the API request sending, and retry logic for the SDK. This package also includes utilities for defining your own request retryer, and configuring how the SDK processes the request. 
- service - Clients for AWS services. All services supported by the SDK are available under this folder. 
How to Use the SDK's AWS Service Clients ¶
The SDK includes the Go types and utilities you can use to make requests to AWS service APIs. Within the service folder at the root of the SDK you'll find a package for each AWS service the SDK supports. All service clients follows a common pattern of creation and usage.
When creating a client for an AWS service you'll first need to have a Session value constructed. The Session provides shared configuration that can be shared between your service clients. When service clients are created you can pass in additional configuration via the aws.Config type to override configuration provided by in the Session to create service client instances with custom configuration.
Once the service's client is created you can use it to make API requests the AWS service. These clients are safe to use concurrently.
Configuring the SDK ¶
In the AWS SDK for Go, you can configure settings for service clients, such as the log level and maximum number of retries. Most settings are optional; however, for each service client, you must specify a region and your credentials. The SDK uses these values to send requests to the correct AWS region and sign requests with the correct credentials. You can specify these values as part of a session or as environment variables.
See the SDK's configuration guide for more information. https://docs.aws.amazon.com/sdk-for-go/v1/developer-guide/configuring-sdk.html
See the session package documentation for more information on how to use Session with the SDK. https://docs.aws.amazon.com/sdk-for-go/api/aws/session/
See the Config type in the aws package for more information on configuration options. https://docs.aws.amazon.com/sdk-for-go/api/aws/#Config
Configuring Credentials ¶
When using the SDK you'll generally need your AWS credentials to authenticate with AWS services. The SDK supports multiple methods of supporting these credentials. By default the SDK will source credentials automatically from its default credential chain. See the session package for more information on this chain, and how to configure it. The common items in the credential chain are the following:
- Environment Credentials - Set of environment variables that are useful when sub processes are created for specific roles. 
- Shared Credentials file (~/.aws/credentials) - This file stores your credentials based on a profile name and is useful for local development. 
- EC2 Instance Role Credentials - Use EC2 Instance Role to assign credentials to application running on an EC2 instance. This removes the need to manage credential files in production. 
Credentials can be configured in code as well by setting the Config's Credentials value to a custom provider or using one of the providers included with the SDK to bypass the default credential chain and use a custom one. This is helpful when you want to instruct the SDK to only use a specific set of credentials or providers.
This example creates a credential provider for assuming an IAM role, "myRoleARN" and configures the S3 service client to use that role for API requests.
// Initial credentials loaded from SDK's default credential chain. Such as
// the environment, shared credentials (~/.aws/credentials), or EC2 Instance
// Role. These credentials will be used to to make the STS Assume Role API.
sess := session.Must(session.NewSession())
// Create the credentials from AssumeRoleProvider to assume the role
// referenced by the "myRoleARN" ARN.
creds := stscreds.NewCredentials(sess, "myRoleArn")
// Create service client value configured for credentials
// from assumed role.
svc := s3.New(sess, &aws.Config{Credentials: creds})/
See the credentials package documentation for more information on credential providers included with the SDK, and how to customize the SDK's usage of credentials. https://docs.aws.amazon.com/sdk-for-go/api/aws/credentials
The SDK has support for the shared configuration file (~/.aws/config). This support can be enabled by setting the environment variable, "AWS_SDK_LOAD_CONFIG=1", or enabling the feature in code when creating a Session via the Option's SharedConfigState parameter.
sess := session.Must(session.NewSessionWithOptions(session.Options{
    SharedConfigState: session.SharedConfigEnable,
}))
Configuring AWS Region ¶
In addition to the credentials you'll need to specify the region the SDK will use to make AWS API requests to. In the SDK you can specify the region either with an environment variable, or directly in code when a Session or service client is created. The last value specified in code wins if the region is specified multiple ways.
To set the region via the environment variable set the "AWS_REGION" to the region you want to the SDK to use. Using this method to set the region will allow you to run your application in multiple regions without needing additional code in the application to select the region.
AWS_REGION=us-west-2
The endpoints package includes constants for all regions the SDK knows. The values are all suffixed with RegionID. These values are helpful, because they reduce the need to type the region string manually.
To set the region on a Session use the aws package's Config struct parameter Region to the AWS region you want the service clients created from the session to use. This is helpful when you want to create multiple service clients, and all of the clients make API requests to the same region.
sess := session.Must(session.NewSession(&aws.Config{
    Region: aws.String(endpoints.UsWest2RegionID),
}))
See the endpoints package for the AWS Regions and Endpoints metadata. https://docs.aws.amazon.com/sdk-for-go/api/aws/endpoints/
In addition to setting the region when creating a Session you can also set the region on a per service client bases. This overrides the region of a Session. This is helpful when you want to create service clients in specific regions different from the Session's region.
svc := s3.New(sess, &aws.Config{
    Region: aws.String(endpoints.UsWest2RegionID),
})
See the Config type in the aws package for more information and additional options such as setting the Endpoint, and other service client configuration options. https://docs.aws.amazon.com/sdk-for-go/api/aws/#Config
Making API Requests ¶
Once the client is created you can make an API request to the service. Each API method takes a input parameter, and returns the service response and an error. The SDK provides methods for making the API call in multiple ways.
In this list we'll use the S3 ListObjects API as an example for the different ways of making API requests.
- ListObjects - Base API operation that will make the API request to the service. 
- ListObjectsRequest - API methods suffixed with Request will construct the API request, but not send it. This is also helpful when you want to get a presigned URL for a request, and share the presigned URL instead of your application making the request directly. 
- ListObjectsPages - Same as the base API operation, but uses a callback to automatically handle pagination of the API's response. 
- ListObjectsWithContext - Same as base API operation, but adds support for the Context pattern. This is helpful for controlling the canceling of in flight requests. See the Go standard library context package for more information. This method also takes request package's Option functional options as the variadic argument for modifying how the request will be made, or extracting information from the raw HTTP response. 
- ListObjectsPagesWithContext - same as ListObjectsPages, but adds support for the Context pattern. Similar to ListObjectsWithContext this method also takes the request package's Option function option types as the variadic argument. 
In addition to the API operations the SDK also includes several higher level methods that abstract checking for and waiting for an AWS resource to be in a desired state. In this list we'll use WaitUntilBucketExists to demonstrate the different forms of waiters.
- WaitUntilBucketExists. - Method to make API request to query an AWS service for a resource's state. Will return successfully when that state is accomplished. 
- WaitUntilBucketExistsWithContext - Same as WaitUntilBucketExists, but adds support for the Context pattern. In addition these methods take request package's WaiterOptions to configure the waiter, and how underlying request will be made by the SDK. 
The API method will document which error codes the service might return for the operation. These errors will also be available as const strings prefixed with "ErrCode" in the service client's package. If there are no errors listed in the API's SDK documentation you'll need to consult the AWS service's API documentation for the errors that could be returned.
ctx := context.Background()
result, err := svc.GetObjectWithContext(ctx, &s3.GetObjectInput{
    Bucket: aws.String("my-bucket"),
    Key: aws.String("my-key"),
})
if err != nil {
    // Cast err to awserr.Error to handle specific error codes.
    aerr, ok := err.(awserr.Error)
    if ok && aerr.Code() == s3.ErrCodeNoSuchKey {
        // Specific error code handling
    }
    return err
}
// Make sure to close the body when done with it for S3 GetObject APIs or
// will leak connections.
defer result.Body.Close()
fmt.Println("Object Size:", aws.StringValue(result.ContentLength))
API Request Pagination and Resource Waiters ¶
Pagination helper methods are suffixed with "Pages", and provide the functionality needed to round trip API page requests. Pagination methods take a callback function that will be called for each page of the API's response.
objects := []string{}
err := svc.ListObjectsPagesWithContext(ctx, &s3.ListObjectsInput{
    Bucket: aws.String(myBucket),
}, func(p *s3.ListObjectsOutput, lastPage bool) bool {
    for _, o := range p.Contents {
        objects = append(objects, aws.StringValue(o.Key))
    }
    return true // continue paging
})
if err != nil {
    panic(fmt.Sprintf("failed to list objects for bucket, %s, %v", myBucket, err))
}
fmt.Println("Objects in bucket:", objects)
Waiter helper methods provide the functionality to wait for an AWS resource state. These methods abstract the logic needed to to check the state of an AWS resource, and wait until that resource is in a desired state. The waiter will block until the resource is in the state that is desired, an error occurs, or the waiter times out. If a resource times out the error code returned will be request.WaiterResourceNotReadyErrorCode.
err := svc.WaitUntilBucketExistsWithContext(ctx, &s3.HeadBucketInput{
    Bucket: aws.String(myBucket),
})
if err != nil {
    aerr, ok := err.(awserr.Error)
    if ok && aerr.Code() == request.WaiterResourceNotReadyErrorCode {
        fmt.Fprintf(os.Stderr, "timed out while waiting for bucket to exist")
    }
    panic(fmt.Errorf("failed to wait for bucket to exist, %v", err))
}
fmt.Println("Bucket", myBucket, "exists")
Complete SDK Example ¶
This example shows a complete working Go file which will upload a file to S3 and use the Context pattern to implement timeout logic that will cancel the request if it takes too long. This example highlights how to use sessions, create a service client, make a request, handle the error, and process the response.
 package main
 import (
 	"context"
 	"flag"
 	"fmt"
 	"os"
 	"time"
 	"github.com/aws/aws-sdk-go/aws"
 	"github.com/aws/aws-sdk-go/aws/awserr"
 	"github.com/aws/aws-sdk-go/aws/request"
 	"github.com/aws/aws-sdk-go/aws/session"
 	"github.com/aws/aws-sdk-go/service/s3"
 )
 // Uploads a file to S3 given a bucket and object key. Also takes a duration
 // value to terminate the update if it doesn't complete within that time.
 //
 // The AWS Region needs to be provided in the AWS shared config or on the
 // environment variable as `AWS_REGION`. Credentials also must be provided
 // Will default to shared config file, but can load from environment if provided.
 //
 // Usage:
 //   # Upload myfile.txt to myBucket/myKey. Must complete within 10 minutes or will fail
 //   go run withContext.go -b mybucket -k myKey -d 10m < myfile.txt
 func main() {
 	var bucket, key string
 	var timeout time.Duration
 	flag.StringVar(&bucket, "b", "", "Bucket name.")
 	flag.StringVar(&key, "k", "", "Object key name.")
 	flag.DurationVar(&timeout, "d", 0, "Upload timeout.")
 	flag.Parse()
 	// All clients require a Session. The Session provides the client with
	// shared configuration such as region, endpoint, and credentials. A
	// Session should be shared where possible to take advantage of
	// configuration and credential caching. See the session package for
	// more information.
 	sess := session.Must(session.NewSession())
	// Create a new instance of the service's client with a Session.
	// Optional aws.Config values can also be provided as variadic arguments
	// to the New function. This option allows you to provide service
	// specific configuration.
 	svc := s3.New(sess)
 	// Create a context with a timeout that will abort the upload if it takes
 	// more than the passed in timeout.
 	ctx := context.Background()
 	var cancelFn func()
 	if timeout > 0 {
 		ctx, cancelFn = context.WithTimeout(ctx, timeout)
 	}
 	// Ensure the context is canceled to prevent leaking.
 	// See context package for more information, https://golang.org/pkg/context/
 	defer cancelFn()
 	// Uploads the object to S3. The Context will interrupt the request if the
 	// timeout expires.
 	_, err := svc.PutObjectWithContext(ctx, &s3.PutObjectInput{
 		Bucket: aws.String(bucket),
 		Key:    aws.String(key),
 		Body:   os.Stdin,
 	})
 	if err != nil {
 		if aerr, ok := err.(awserr.Error); ok && aerr.Code() == request.CanceledErrorCode {
 			// If the SDK can determine the request or retry delay was canceled
 			// by a context the CanceledErrorCode error code will be returned.
 			fmt.Fprintf(os.Stderr, "upload canceled due to timeout, %v\n", err)
 		} else {
 			fmt.Fprintf(os.Stderr, "failed to upload object, %v\n", err)
 		}
 		os.Exit(1)
 	}
 	fmt.Printf("successfully uploaded file to %s/%s\n", bucket, key)
 }
       Directories
      ¶
      Directories
      ¶
    
    | Path | Synopsis | 
|---|---|
| Package aws provides the core SDK's utilities and shared types. | Package aws provides the core SDK's utilities and shared types. | 
| 
          
            arn
            
            
          
           Package arn provides a parser for interacting with Amazon Resource Names. | Package arn provides a parser for interacting with Amazon Resource Names. | 
| 
          
            awserr
            
            
          
           Package awserr represents API error interface accessors for the SDK. | Package awserr represents API error interface accessors for the SDK. | 
| 
          
            credentials
            
            
          
           Package credentials provides credential retrieval and management The Credentials is the primary method of getting access to and managing credentials Values. | Package credentials provides credential retrieval and management The Credentials is the primary method of getting access to and managing credentials Values. | 
| 
          
            credentials/endpointcreds
            
            
          
           Package endpointcreds provides support for retrieving credentials from an arbitrary HTTP endpoint. | Package endpointcreds provides support for retrieving credentials from an arbitrary HTTP endpoint. | 
| 
          
            credentials/plugincreds
            
            
          
           Package plugincreds implements a credentials provider sourced from a Go plugin. | Package plugincreds implements a credentials provider sourced from a Go plugin. | 
| 
          
            credentials/stscreds
            
            
          
           Package stscreds are credential Providers to retrieve STS AWS credentials. | Package stscreds are credential Providers to retrieve STS AWS credentials. | 
| 
          
            csm
            
            
          
           Package csm provides Client Side Monitoring (CSM) which enables sending metrics via UDP connection. | Package csm provides Client Side Monitoring (CSM) which enables sending metrics via UDP connection. | 
| 
          
            defaults
            
            
          
           Package defaults is a collection of helpers to retrieve the SDK's default configuration and handlers. | Package defaults is a collection of helpers to retrieve the SDK's default configuration and handlers. | 
| 
          
            ec2metadata
            
            
          
           Package ec2metadata provides the client for making API calls to the EC2 Metadata service. | Package ec2metadata provides the client for making API calls to the EC2 Metadata service. | 
| 
          
            endpoints
            
            
          
           Package endpoints provides the types and functionality for defining regions and endpoints, as well as querying those definitions. | Package endpoints provides the types and functionality for defining regions and endpoints, as well as querying those definitions. | 
| 
          
            session
            
            
          
           Package session provides configuration for the SDK's service clients. | Package session provides configuration for the SDK's service clients. | 
| 
          
            signer/v4
            
            
          
           Package v4 implements signing for AWS V4 signer Provides request signing for request that need to be signed with AWS V4 Signatures. | Package v4 implements signing for AWS V4 signer Provides request signing for request that need to be signed with AWS V4 Signatures. | 
| 
          
            unit
            
            
          
           Package unit performs initialization and validation for unit tests | Package unit performs initialization and validation for unit tests | 
| internal
       | |
| models
       | |
| 
          
            endpoints
            
            
          
           Package endpoints contains the models for endpoints that should be used to generate endpoint definition files for the SDK. | Package endpoints contains the models for endpoints that should be used to generate endpoint definition files for the SDK. | 
| private
       | |
| 
          
            protocol/ec2query
            
            
          
           Package ec2query provides serialization of AWS EC2 requests and responses. | Package ec2query provides serialization of AWS EC2 requests and responses. | 
| 
          
            protocol/json/jsonutil
            
            
          
           Package jsonutil provides JSON serialization of AWS requests and responses. | Package jsonutil provides JSON serialization of AWS requests and responses. | 
| 
          
            protocol/jsonrpc
            
            
          
           Package jsonrpc provides JSON RPC utilities for serialization of AWS requests and responses. | Package jsonrpc provides JSON RPC utilities for serialization of AWS requests and responses. | 
| 
          
            protocol/query
            
            
          
           Package query provides serialization of AWS query requests, and responses. | Package query provides serialization of AWS query requests, and responses. | 
| 
          
            protocol/rest
            
            
          
           Package rest provides RESTful serialization of AWS requests and responses. | Package rest provides RESTful serialization of AWS requests and responses. | 
| 
          
            protocol/restjson
            
            
          
           Package restjson provides RESTful JSON serialization of AWS requests and responses. | Package restjson provides RESTful JSON serialization of AWS requests and responses. | 
| 
          
            protocol/restxml
            
            
          
           Package restxml provides RESTful XML serialization of AWS requests and responses. | Package restxml provides RESTful XML serialization of AWS requests and responses. | 
| 
          
            protocol/xml/xmlutil
            
            
          
           Package xmlutil provides XML serialization of AWS requests and responses. | Package xmlutil provides XML serialization of AWS requests and responses. | 
| Package service contains automatically generated AWS clients. | Package service contains automatically generated AWS clients. | 
| 
          
            acm
            
            
          
           Package acm provides the client and types for making API requests to AWS Certificate Manager. | Package acm provides the client and types for making API requests to AWS Certificate Manager. | 
| 
          
            acm/acmiface
            
            
          
           Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code. | Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code. | 
| 
          
            acmpca
            
            
          
           Package acmpca provides the client and types for making API requests to AWS Certificate Manager Private Certificate Authority. | Package acmpca provides the client and types for making API requests to AWS Certificate Manager Private Certificate Authority. | 
| 
          
            acmpca/acmpcaiface
            
            
          
           Package acmpcaiface provides an interface to enable mocking the AWS Certificate Manager Private Certificate Authority service client for testing your code. | Package acmpcaiface provides an interface to enable mocking the AWS Certificate Manager Private Certificate Authority service client for testing your code. | 
| 
          
            alexaforbusiness
            
            
          
           Package alexaforbusiness provides the client and types for making API requests to Alexa For Business. | Package alexaforbusiness provides the client and types for making API requests to Alexa For Business. | 
| 
          
            alexaforbusiness/alexaforbusinessiface
            
            
          
           Package alexaforbusinessiface provides an interface to enable mocking the Alexa For Business service client for testing your code. | Package alexaforbusinessiface provides an interface to enable mocking the Alexa For Business service client for testing your code. | 
| 
          
            apigateway
            
            
          
           Package apigateway provides the client and types for making API requests to Amazon API Gateway. | Package apigateway provides the client and types for making API requests to Amazon API Gateway. | 
| 
          
            apigateway/apigatewayiface
            
            
          
           Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code. | Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code. | 
| 
          
            applicationautoscaling
            
            
          
           Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling. | Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling. | 
| 
          
            applicationautoscaling/applicationautoscalingiface
            
            
          
           Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code. | Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code. | 
| 
          
            applicationdiscoveryservice
            
            
          
           Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service. | Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service. | 
| 
          
            applicationdiscoveryservice/applicationdiscoveryserviceiface
            
            
          
           Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code. | Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code. | 
| 
          
            appstream
            
            
          
           Package appstream provides the client and types for making API requests to Amazon AppStream. | Package appstream provides the client and types for making API requests to Amazon AppStream. | 
| 
          
            appstream/appstreamiface
            
            
          
           Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code. | Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code. | 
| 
          
            appsync
            
            
          
           Package appsync provides the client and types for making API requests to AWS AppSync. | Package appsync provides the client and types for making API requests to AWS AppSync. | 
| 
          
            appsync/appsynciface
            
            
          
           Package appsynciface provides an interface to enable mocking the AWS AppSync service client for testing your code. | Package appsynciface provides an interface to enable mocking the AWS AppSync service client for testing your code. | 
| 
          
            athena
            
            
          
           Package athena provides the client and types for making API requests to Amazon Athena. | Package athena provides the client and types for making API requests to Amazon Athena. | 
| 
          
            athena/athenaiface
            
            
          
           Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code. | Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code. | 
| 
          
            autoscaling
            
            
          
           Package autoscaling provides the client and types for making API requests to Auto Scaling. | Package autoscaling provides the client and types for making API requests to Auto Scaling. | 
| 
          
            autoscaling/autoscalingiface
            
            
          
           Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code. | Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code. | 
| 
          
            autoscalingplans
            
            
          
           Package autoscalingplans provides the client and types for making API requests to AWS Auto Scaling Plans. | Package autoscalingplans provides the client and types for making API requests to AWS Auto Scaling Plans. | 
| 
          
            autoscalingplans/autoscalingplansiface
            
            
          
           Package autoscalingplansiface provides an interface to enable mocking the AWS Auto Scaling Plans service client for testing your code. | Package autoscalingplansiface provides an interface to enable mocking the AWS Auto Scaling Plans service client for testing your code. | 
| 
          
            batch
            
            
          
           Package batch provides the client and types for making API requests to AWS Batch. | Package batch provides the client and types for making API requests to AWS Batch. | 
| 
          
            batch/batchiface
            
            
          
           Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code. | Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code. | 
| 
          
            budgets
            
            
          
           Package budgets provides the client and types for making API requests to AWS Budgets. | Package budgets provides the client and types for making API requests to AWS Budgets. | 
| 
          
            budgets/budgetsiface
            
            
          
           Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code. | Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code. | 
| 
          
            cloud9
            
            
          
           Package cloud9 provides the client and types for making API requests to AWS Cloud9. | Package cloud9 provides the client and types for making API requests to AWS Cloud9. | 
| 
          
            cloud9/cloud9iface
            
            
          
           Package cloud9iface provides an interface to enable mocking the AWS Cloud9 service client for testing your code. | Package cloud9iface provides an interface to enable mocking the AWS Cloud9 service client for testing your code. | 
| 
          
            clouddirectory
            
            
          
           Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory. | Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory. | 
| 
          
            clouddirectory/clouddirectoryiface
            
            
          
           Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code. | Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code. | 
| 
          
            cloudformation
            
            
          
           Package cloudformation provides the client and types for making API requests to AWS CloudFormation. | Package cloudformation provides the client and types for making API requests to AWS CloudFormation. | 
| 
          
            cloudformation/cloudformationiface
            
            
          
           Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code. | Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code. | 
| 
          
            cloudfront
            
            
          
           Package cloudfront provides the client and types for making API requests to Amazon CloudFront. | Package cloudfront provides the client and types for making API requests to Amazon CloudFront. | 
| 
          
            cloudfront/cloudfrontiface
            
            
          
           Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code. | Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code. | 
| 
          
            cloudfront/sign
            
            
          
           Package sign provides utilities to generate signed URLs for Amazon CloudFront. | Package sign provides utilities to generate signed URLs for Amazon CloudFront. | 
| 
          
            cloudhsm
            
            
          
           Package cloudhsm provides the client and types for making API requests to Amazon CloudHSM. | Package cloudhsm provides the client and types for making API requests to Amazon CloudHSM. | 
| 
          
            cloudhsm/cloudhsmiface
            
            
          
           Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code. | Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code. | 
| 
          
            cloudhsmv2
            
            
          
           Package cloudhsmv2 provides the client and types for making API requests to AWS CloudHSM V2. | Package cloudhsmv2 provides the client and types for making API requests to AWS CloudHSM V2. | 
| 
          
            cloudhsmv2/cloudhsmv2iface
            
            
          
           Package cloudhsmv2iface provides an interface to enable mocking the AWS CloudHSM V2 service client for testing your code. | Package cloudhsmv2iface provides an interface to enable mocking the AWS CloudHSM V2 service client for testing your code. | 
| 
          
            cloudsearch
            
            
          
           Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch. | Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch. | 
| 
          
            cloudsearch/cloudsearchiface
            
            
          
           Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code. | Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code. | 
| 
          
            cloudsearchdomain
            
            
          
           Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain. | Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain. | 
| 
          
            cloudsearchdomain/cloudsearchdomainiface
            
            
          
           Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code. | Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code. | 
| 
          
            cloudtrail
            
            
          
           Package cloudtrail provides the client and types for making API requests to AWS CloudTrail. | Package cloudtrail provides the client and types for making API requests to AWS CloudTrail. | 
| 
          
            cloudtrail/cloudtrailiface
            
            
          
           Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code. | Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code. | 
| 
          
            cloudwatch
            
            
          
           Package cloudwatch provides the client and types for making API requests to Amazon CloudWatch. | Package cloudwatch provides the client and types for making API requests to Amazon CloudWatch. | 
| 
          
            cloudwatch/cloudwatchiface
            
            
          
           Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code. | Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code. | 
| 
          
            cloudwatchevents
            
            
          
           Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events. | Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events. | 
| 
          
            cloudwatchevents/cloudwatcheventsiface
            
            
          
           Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code. | Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code. | 
| 
          
            cloudwatchlogs
            
            
          
           Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs. | Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs. | 
| 
          
            cloudwatchlogs/cloudwatchlogsiface
            
            
          
           Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code. | Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code. | 
| 
          
            codebuild
            
            
          
           Package codebuild provides the client and types for making API requests to AWS CodeBuild. | Package codebuild provides the client and types for making API requests to AWS CodeBuild. | 
| 
          
            codebuild/codebuildiface
            
            
          
           Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code. | Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code. | 
| 
          
            codecommit
            
            
          
           Package codecommit provides the client and types for making API requests to AWS CodeCommit. | Package codecommit provides the client and types for making API requests to AWS CodeCommit. | 
| 
          
            codecommit/codecommitiface
            
            
          
           Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code. | Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code. | 
| 
          
            codedeploy
            
            
          
           Package codedeploy provides the client and types for making API requests to AWS CodeDeploy. | Package codedeploy provides the client and types for making API requests to AWS CodeDeploy. | 
| 
          
            codedeploy/codedeployiface
            
            
          
           Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code. | Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code. | 
| 
          
            codepipeline
            
            
          
           Package codepipeline provides the client and types for making API requests to AWS CodePipeline. | Package codepipeline provides the client and types for making API requests to AWS CodePipeline. | 
| 
          
            codepipeline/codepipelineiface
            
            
          
           Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code. | Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code. | 
| 
          
            codestar
            
            
          
           Package codestar provides the client and types for making API requests to AWS CodeStar. | Package codestar provides the client and types for making API requests to AWS CodeStar. | 
| 
          
            codestar/codestariface
            
            
          
           Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code. | Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code. | 
| 
          
            cognitoidentity
            
            
          
           Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity. | Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity. | 
| 
          
            cognitoidentity/cognitoidentityiface
            
            
          
           Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code. | Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code. | 
| 
          
            cognitoidentityprovider
            
            
          
           Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider. | Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider. | 
| 
          
            cognitoidentityprovider/cognitoidentityprovideriface
            
            
          
           Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code. | Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code. | 
| 
          
            cognitosync
            
            
          
           Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync. | Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync. | 
| 
          
            cognitosync/cognitosynciface
            
            
          
           Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code. | Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code. | 
| 
          
            comprehend
            
            
          
           Package comprehend provides the client and types for making API requests to Amazon Comprehend. | Package comprehend provides the client and types for making API requests to Amazon Comprehend. | 
| 
          
            comprehend/comprehendiface
            
            
          
           Package comprehendiface provides an interface to enable mocking the Amazon Comprehend service client for testing your code. | Package comprehendiface provides an interface to enable mocking the Amazon Comprehend service client for testing your code. | 
| 
          
            configservice
            
            
          
           Package configservice provides the client and types for making API requests to AWS Config. | Package configservice provides the client and types for making API requests to AWS Config. | 
| 
          
            configservice/configserviceiface
            
            
          
           Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code. | Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code. | 
| 
          
            connect
            
            
          
           Package connect provides the client and types for making API requests to Amazon Connect Service. | Package connect provides the client and types for making API requests to Amazon Connect Service. | 
| 
          
            connect/connectiface
            
            
          
           Package connectiface provides an interface to enable mocking the Amazon Connect Service service client for testing your code. | Package connectiface provides an interface to enable mocking the Amazon Connect Service service client for testing your code. | 
| 
          
            costandusagereportservice
            
            
          
           Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service. | Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service. | 
| 
          
            costandusagereportservice/costandusagereportserviceiface
            
            
          
           Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code. | Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code. | 
| 
          
            costexplorer
            
            
          
           Package costexplorer provides the client and types for making API requests to AWS Cost Explorer Service. | Package costexplorer provides the client and types for making API requests to AWS Cost Explorer Service. | 
| 
          
            costexplorer/costexploreriface
            
            
          
           Package costexploreriface provides an interface to enable mocking the AWS Cost Explorer Service service client for testing your code. | Package costexploreriface provides an interface to enable mocking the AWS Cost Explorer Service service client for testing your code. | 
| 
          
            databasemigrationservice
            
            
          
           Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service. | Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service. | 
| 
          
            databasemigrationservice/databasemigrationserviceiface
            
            
          
           Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code. | Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code. | 
| 
          
            datapipeline
            
            
          
           Package datapipeline provides the client and types for making API requests to AWS Data Pipeline. | Package datapipeline provides the client and types for making API requests to AWS Data Pipeline. | 
| 
          
            datapipeline/datapipelineiface
            
            
          
           Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code. | Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code. | 
| 
          
            dax
            
            
          
           Package dax provides the client and types for making API requests to Amazon DynamoDB Accelerator (DAX). | Package dax provides the client and types for making API requests to Amazon DynamoDB Accelerator (DAX). | 
| 
          
            dax/daxiface
            
            
          
           Package daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code. | Package daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code. | 
| 
          
            devicefarm
            
            
          
           Package devicefarm provides the client and types for making API requests to AWS Device Farm. | Package devicefarm provides the client and types for making API requests to AWS Device Farm. | 
| 
          
            devicefarm/devicefarmiface
            
            
          
           Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code. | Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code. | 
| 
          
            directconnect
            
            
          
           Package directconnect provides the client and types for making API requests to AWS Direct Connect. | Package directconnect provides the client and types for making API requests to AWS Direct Connect. | 
| 
          
            directconnect/directconnectiface
            
            
          
           Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code. | Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code. | 
| 
          
            directoryservice
            
            
          
           Package directoryservice provides the client and types for making API requests to AWS Directory Service. | Package directoryservice provides the client and types for making API requests to AWS Directory Service. | 
| 
          
            directoryservice/directoryserviceiface
            
            
          
           Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code. | Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code. | 
| 
          
            dynamodb
            
            
          
           Package dynamodb provides the client and types for making API requests to Amazon DynamoDB. | Package dynamodb provides the client and types for making API requests to Amazon DynamoDB. | 
| 
          
            dynamodb/dynamodbattribute
            
            
          
           Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues. | Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues. | 
| 
          
            dynamodb/dynamodbiface
            
            
          
           Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code. | Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code. | 
| 
          
            dynamodb/expression
            
            
          
           Package expression provides types and functions to create Amazon DynamoDB Expression strings, ExpressionAttributeNames maps, and ExpressionAttributeValues maps. | Package expression provides types and functions to create Amazon DynamoDB Expression strings, ExpressionAttributeNames maps, and ExpressionAttributeValues maps. | 
| 
          
            dynamodbstreams
            
            
          
           Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams. | Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams. | 
| 
          
            dynamodbstreams/dynamodbstreamsiface
            
            
          
           Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code. | Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code. | 
| 
          
            ec2
            
            
          
           Package ec2 provides the client and types for making API requests to Amazon Elastic Compute Cloud. | Package ec2 provides the client and types for making API requests to Amazon Elastic Compute Cloud. | 
| 
          
            ec2/ec2iface
            
            
          
           Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code. | Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code. | 
| 
          
            ecr
            
            
          
           Package ecr provides the client and types for making API requests to Amazon EC2 Container Registry. | Package ecr provides the client and types for making API requests to Amazon EC2 Container Registry. | 
| 
          
            ecr/ecriface
            
            
          
           Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code. | Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code. | 
| 
          
            ecs
            
            
          
           Package ecs provides the client and types for making API requests to Amazon EC2 Container Service. | Package ecs provides the client and types for making API requests to Amazon EC2 Container Service. | 
| 
          
            ecs/ecsiface
            
            
          
           Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code. | Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code. | 
| 
          
            efs
            
            
          
           Package efs provides the client and types for making API requests to Amazon Elastic File System. | Package efs provides the client and types for making API requests to Amazon Elastic File System. | 
| 
          
            efs/efsiface
            
            
          
           Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code. | Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code. | 
| 
          
            eks
            
            
          
           Package eks provides the client and types for making API requests to Amazon Elastic Container Service for Kubernetes. | Package eks provides the client and types for making API requests to Amazon Elastic Container Service for Kubernetes. | 
| 
          
            eks/eksiface
            
            
          
           Package eksiface provides an interface to enable mocking the Amazon Elastic Container Service for Kubernetes service client for testing your code. | Package eksiface provides an interface to enable mocking the Amazon Elastic Container Service for Kubernetes service client for testing your code. | 
| 
          
            elasticache
            
            
          
           Package elasticache provides the client and types for making API requests to Amazon ElastiCache. | Package elasticache provides the client and types for making API requests to Amazon ElastiCache. | 
| 
          
            elasticache/elasticacheiface
            
            
          
           Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code. | Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code. | 
| 
          
            elasticbeanstalk
            
            
          
           Package elasticbeanstalk provides the client and types for making API requests to AWS Elastic Beanstalk. | Package elasticbeanstalk provides the client and types for making API requests to AWS Elastic Beanstalk. | 
| 
          
            elasticbeanstalk/elasticbeanstalkiface
            
            
          
           Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code. | Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code. | 
| 
          
            elasticsearchservice
            
            
          
           Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service. | Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service. | 
| 
          
            elasticsearchservice/elasticsearchserviceiface
            
            
          
           Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code. | Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code. | 
| 
          
            elastictranscoder
            
            
          
           Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder. | Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder. | 
| 
          
            elastictranscoder/elastictranscoderiface
            
            
          
           Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code. | Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code. | 
| 
          
            elb
            
            
          
           Package elb provides the client and types for making API requests to Elastic Load Balancing. | Package elb provides the client and types for making API requests to Elastic Load Balancing. | 
| 
          
            elb/elbiface
            
            
          
           Package elbiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code. | Package elbiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code. | 
| 
          
            elbv2
            
            
          
           Package elbv2 provides the client and types for making API requests to Elastic Load Balancing. | Package elbv2 provides the client and types for making API requests to Elastic Load Balancing. | 
| 
          
            elbv2/elbv2iface
            
            
          
           Package elbv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code. | Package elbv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code. | 
| 
          
            emr
            
            
          
           Package emr provides the client and types for making API requests to Amazon Elastic MapReduce. | Package emr provides the client and types for making API requests to Amazon Elastic MapReduce. | 
| 
          
            emr/emriface
            
            
          
           Package emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code. | Package emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code. | 
| 
          
            firehose
            
            
          
           Package firehose provides the client and types for making API requests to Amazon Kinesis Firehose. | Package firehose provides the client and types for making API requests to Amazon Kinesis Firehose. | 
| 
          
            firehose/firehoseiface
            
            
          
           Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code. | Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code. | 
| 
          
            fms
            
            
          
           Package fms provides the client and types for making API requests to Firewall Management Service. | Package fms provides the client and types for making API requests to Firewall Management Service. | 
| 
          
            fms/fmsiface
            
            
          
           Package fmsiface provides an interface to enable mocking the Firewall Management Service service client for testing your code. | Package fmsiface provides an interface to enable mocking the Firewall Management Service service client for testing your code. | 
| 
          
            gamelift
            
            
          
           Package gamelift provides the client and types for making API requests to Amazon GameLift. | Package gamelift provides the client and types for making API requests to Amazon GameLift. | 
| 
          
            gamelift/gameliftiface
            
            
          
           Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code. | Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code. | 
| 
          
            glacier
            
            
          
           Package glacier provides the client and types for making API requests to Amazon Glacier. | Package glacier provides the client and types for making API requests to Amazon Glacier. | 
| 
          
            glacier/glacieriface
            
            
          
           Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code. | Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code. | 
| 
          
            glue
            
            
          
           Package glue provides the client and types for making API requests to AWS Glue. | Package glue provides the client and types for making API requests to AWS Glue. | 
| 
          
            glue/glueiface
            
            
          
           Package glueiface provides an interface to enable mocking the AWS Glue service client for testing your code. | Package glueiface provides an interface to enable mocking the AWS Glue service client for testing your code. | 
| 
          
            greengrass
            
            
          
           Package greengrass provides the client and types for making API requests to AWS Greengrass. | Package greengrass provides the client and types for making API requests to AWS Greengrass. | 
| 
          
            greengrass/greengrassiface
            
            
          
           Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code. | Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code. | 
| 
          
            guardduty
            
            
          
           Package guardduty provides the client and types for making API requests to Amazon GuardDuty. | Package guardduty provides the client and types for making API requests to Amazon GuardDuty. | 
| 
          
            guardduty/guarddutyiface
            
            
          
           Package guarddutyiface provides an interface to enable mocking the Amazon GuardDuty service client for testing your code. | Package guarddutyiface provides an interface to enable mocking the Amazon GuardDuty service client for testing your code. | 
| 
          
            health
            
            
          
           Package health provides the client and types for making API requests to AWS Health APIs and Notifications. | Package health provides the client and types for making API requests to AWS Health APIs and Notifications. | 
| 
          
            health/healthiface
            
            
          
           Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code. | Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code. | 
| 
          
            iam
            
            
          
           Package iam provides the client and types for making API requests to AWS Identity and Access Management. | Package iam provides the client and types for making API requests to AWS Identity and Access Management. | 
| 
          
            iam/iamiface
            
            
          
           Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code. | Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code. | 
| 
          
            inspector
            
            
          
           Package inspector provides the client and types for making API requests to Amazon Inspector. | Package inspector provides the client and types for making API requests to Amazon Inspector. | 
| 
          
            inspector/inspectoriface
            
            
          
           Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code. | Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code. | 
| 
          
            iot
            
            
          
           Package iot provides the client and types for making API requests to AWS IoT. AWS IoT provides secure, bi-directional communication between Internet-connected devices (such as sensors, actuators, embedded devices, or smart appliances) and the AWS cloud. | Package iot provides the client and types for making API requests to AWS IoT. AWS IoT provides secure, bi-directional communication between Internet-connected devices (such as sensors, actuators, embedded devices, or smart appliances) and the AWS cloud. | 
| 
          
            iot/iotiface
            
            
          
           Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code. | Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code. | 
| 
          
            iot1clickdevicesservice
            
            
          
           Package iot1clickdevicesservice provides the client and types for making API requests to AWS IoT 1-Click Devices Service. | Package iot1clickdevicesservice provides the client and types for making API requests to AWS IoT 1-Click Devices Service. | 
| 
          
            iot1clickdevicesservice/iot1clickdevicesserviceiface
            
            
          
           Package iot1clickdevicesserviceiface provides an interface to enable mocking the AWS IoT 1-Click Devices Service service client for testing your code. | Package iot1clickdevicesserviceiface provides an interface to enable mocking the AWS IoT 1-Click Devices Service service client for testing your code. | 
| 
          
            iot1clickprojects
            
            
          
           Package iot1clickprojects provides the client and types for making API requests to AWS IoT 1-Click Projects Service. | Package iot1clickprojects provides the client and types for making API requests to AWS IoT 1-Click Projects Service. | 
| 
          
            iot1clickprojects/iot1clickprojectsiface
            
            
          
           Package iot1clickprojectsiface provides an interface to enable mocking the AWS IoT 1-Click Projects Service service client for testing your code. | Package iot1clickprojectsiface provides an interface to enable mocking the AWS IoT 1-Click Projects Service service client for testing your code. | 
| 
          
            iotanalytics
            
            
          
           Package iotanalytics provides the client and types for making API requests to AWS IoT Analytics. | Package iotanalytics provides the client and types for making API requests to AWS IoT Analytics. | 
| 
          
            iotanalytics/iotanalyticsiface
            
            
          
           Package iotanalyticsiface provides an interface to enable mocking the AWS IoT Analytics service client for testing your code. | Package iotanalyticsiface provides an interface to enable mocking the AWS IoT Analytics service client for testing your code. | 
| 
          
            iotdataplane
            
            
          
           Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane. | Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane. | 
| 
          
            iotdataplane/iotdataplaneiface
            
            
          
           Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code. | Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code. | 
| 
          
            iotjobsdataplane
            
            
          
           Package iotjobsdataplane provides the client and types for making API requests to AWS IoT Jobs Data Plane. | Package iotjobsdataplane provides the client and types for making API requests to AWS IoT Jobs Data Plane. | 
| 
          
            iotjobsdataplane/iotjobsdataplaneiface
            
            
          
           Package iotjobsdataplaneiface provides an interface to enable mocking the AWS IoT Jobs Data Plane service client for testing your code. | Package iotjobsdataplaneiface provides an interface to enable mocking the AWS IoT Jobs Data Plane service client for testing your code. | 
| 
          
            kinesis
            
            
          
           Package kinesis provides the client and types for making API requests to Amazon Kinesis. | Package kinesis provides the client and types for making API requests to Amazon Kinesis. | 
| 
          
            kinesis/kinesisiface
            
            
          
           Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code. | Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code. | 
| 
          
            kinesisanalytics
            
            
          
           Package kinesisanalytics provides the client and types for making API requests to Amazon Kinesis Analytics. | Package kinesisanalytics provides the client and types for making API requests to Amazon Kinesis Analytics. | 
| 
          
            kinesisanalytics/kinesisanalyticsiface
            
            
          
           Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code. | Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code. | 
| 
          
            kinesisvideo
            
            
          
           Package kinesisvideo provides the client and types for making API requests to Amazon Kinesis Video Streams. | Package kinesisvideo provides the client and types for making API requests to Amazon Kinesis Video Streams. | 
| 
          
            kinesisvideo/kinesisvideoiface
            
            
          
           Package kinesisvideoiface provides an interface to enable mocking the Amazon Kinesis Video Streams service client for testing your code. | Package kinesisvideoiface provides an interface to enable mocking the Amazon Kinesis Video Streams service client for testing your code. | 
| 
          
            kinesisvideoarchivedmedia
            
            
          
           Package kinesisvideoarchivedmedia provides the client and types for making API requests to Amazon Kinesis Video Streams Archived Media. | Package kinesisvideoarchivedmedia provides the client and types for making API requests to Amazon Kinesis Video Streams Archived Media. | 
| 
          
            kinesisvideoarchivedmedia/kinesisvideoarchivedmediaiface
            
            
          
           Package kinesisvideoarchivedmediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Archived Media service client for testing your code. | Package kinesisvideoarchivedmediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Archived Media service client for testing your code. | 
| 
          
            kinesisvideomedia
            
            
          
           Package kinesisvideomedia provides the client and types for making API requests to Amazon Kinesis Video Streams Media. | Package kinesisvideomedia provides the client and types for making API requests to Amazon Kinesis Video Streams Media. | 
| 
          
            kinesisvideomedia/kinesisvideomediaiface
            
            
          
           Package kinesisvideomediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Media service client for testing your code. | Package kinesisvideomediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Media service client for testing your code. | 
| 
          
            kms
            
            
          
           Package kms provides the client and types for making API requests to AWS Key Management Service. | Package kms provides the client and types for making API requests to AWS Key Management Service. | 
| 
          
            kms/kmsiface
            
            
          
           Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code. | Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code. | 
| 
          
            lambda
            
            
          
           Package lambda provides the client and types for making API requests to AWS Lambda. | Package lambda provides the client and types for making API requests to AWS Lambda. | 
| 
          
            lambda/lambdaiface
            
            
          
           Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code. | Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code. | 
| 
          
            lexmodelbuildingservice
            
            
          
           Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service. | Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service. | 
| 
          
            lexmodelbuildingservice/lexmodelbuildingserviceiface
            
            
          
           Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code. | Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code. | 
| 
          
            lexruntimeservice
            
            
          
           Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service. | Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service. | 
| 
          
            lexruntimeservice/lexruntimeserviceiface
            
            
          
           Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code. | Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code. | 
| 
          
            lightsail
            
            
          
           Package lightsail provides the client and types for making API requests to Amazon Lightsail. | Package lightsail provides the client and types for making API requests to Amazon Lightsail. | 
| 
          
            lightsail/lightsailiface
            
            
          
           Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code. | Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code. | 
| 
          
            machinelearning
            
            
          
           Package machinelearning provides the client and types for making API requests to Amazon Machine Learning. | Package machinelearning provides the client and types for making API requests to Amazon Machine Learning. | 
| 
          
            machinelearning/machinelearningiface
            
            
          
           Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code. | Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code. | 
| 
          
            macie
            
            
          
           Package macie provides the client and types for making API requests to Amazon Macie. | Package macie provides the client and types for making API requests to Amazon Macie. | 
| 
          
            macie/macieiface
            
            
          
           Package macieiface provides an interface to enable mocking the Amazon Macie service client for testing your code. | Package macieiface provides an interface to enable mocking the Amazon Macie service client for testing your code. | 
| 
          
            marketplacecommerceanalytics
            
            
          
           Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics. | Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics. | 
| 
          
            marketplacecommerceanalytics/marketplacecommerceanalyticsiface
            
            
          
           Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code. | Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code. | 
| 
          
            marketplaceentitlementservice
            
            
          
           Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service. | Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service. | 
| 
          
            marketplaceentitlementservice/marketplaceentitlementserviceiface
            
            
          
           Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code. | Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code. | 
| 
          
            marketplacemetering
            
            
          
           Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering. | Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering. | 
| 
          
            marketplacemetering/marketplacemeteringiface
            
            
          
           Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code. | Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code. | 
| 
          
            mediaconvert
            
            
          
           Package mediaconvert provides the client and types for making API requests to AWS Elemental MediaConvert. | Package mediaconvert provides the client and types for making API requests to AWS Elemental MediaConvert. | 
| 
          
            mediaconvert/mediaconvertiface
            
            
          
           Package mediaconvertiface provides an interface to enable mocking the AWS Elemental MediaConvert service client for testing your code. | Package mediaconvertiface provides an interface to enable mocking the AWS Elemental MediaConvert service client for testing your code. | 
| 
          
            medialive
            
            
          
           Package medialive provides the client and types for making API requests to AWS Elemental MediaLive. | Package medialive provides the client and types for making API requests to AWS Elemental MediaLive. | 
| 
          
            medialive/medialiveiface
            
            
          
           Package medialiveiface provides an interface to enable mocking the AWS Elemental MediaLive service client for testing your code. | Package medialiveiface provides an interface to enable mocking the AWS Elemental MediaLive service client for testing your code. | 
| 
          
            mediapackage
            
            
          
           Package mediapackage provides the client and types for making API requests to AWS Elemental MediaPackage. | Package mediapackage provides the client and types for making API requests to AWS Elemental MediaPackage. | 
| 
          
            mediapackage/mediapackageiface
            
            
          
           Package mediapackageiface provides an interface to enable mocking the AWS Elemental MediaPackage service client for testing your code. | Package mediapackageiface provides an interface to enable mocking the AWS Elemental MediaPackage service client for testing your code. | 
| 
          
            mediastore
            
            
          
           Package mediastore provides the client and types for making API requests to AWS Elemental MediaStore. | Package mediastore provides the client and types for making API requests to AWS Elemental MediaStore. | 
| 
          
            mediastore/mediastoreiface
            
            
          
           Package mediastoreiface provides an interface to enable mocking the AWS Elemental MediaStore service client for testing your code. | Package mediastoreiface provides an interface to enable mocking the AWS Elemental MediaStore service client for testing your code. | 
| 
          
            mediastoredata
            
            
          
           Package mediastoredata provides the client and types for making API requests to AWS Elemental MediaStore Data Plane. | Package mediastoredata provides the client and types for making API requests to AWS Elemental MediaStore Data Plane. | 
| 
          
            mediastoredata/mediastoredataiface
            
            
          
           Package mediastoredataiface provides an interface to enable mocking the AWS Elemental MediaStore Data Plane service client for testing your code. | Package mediastoredataiface provides an interface to enable mocking the AWS Elemental MediaStore Data Plane service client for testing your code. | 
| 
          
            mediatailor
            
            
          
           Package mediatailor provides the client and types for making API requests to AWS MediaTailor. | Package mediatailor provides the client and types for making API requests to AWS MediaTailor. | 
| 
          
            mediatailor/mediatailoriface
            
            
          
           Package mediatailoriface provides an interface to enable mocking the AWS MediaTailor service client for testing your code. | Package mediatailoriface provides an interface to enable mocking the AWS MediaTailor service client for testing your code. | 
| 
          
            migrationhub
            
            
          
           Package migrationhub provides the client and types for making API requests to AWS Migration Hub. | Package migrationhub provides the client and types for making API requests to AWS Migration Hub. | 
| 
          
            migrationhub/migrationhubiface
            
            
          
           Package migrationhubiface provides an interface to enable mocking the AWS Migration Hub service client for testing your code. | Package migrationhubiface provides an interface to enable mocking the AWS Migration Hub service client for testing your code. | 
| 
          
            mobile
            
            
          
           Package mobile provides the client and types for making API requests to AWS Mobile. | Package mobile provides the client and types for making API requests to AWS Mobile. | 
| 
          
            mobile/mobileiface
            
            
          
           Package mobileiface provides an interface to enable mocking the AWS Mobile service client for testing your code. | Package mobileiface provides an interface to enable mocking the AWS Mobile service client for testing your code. | 
| 
          
            mobileanalytics
            
            
          
           Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics. | Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics. | 
| 
          
            mobileanalytics/mobileanalyticsiface
            
            
          
           Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code. | Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code. | 
| 
          
            mq
            
            
          
           Package mq provides the client and types for making API requests to AmazonMQ. | Package mq provides the client and types for making API requests to AmazonMQ. | 
| 
          
            mq/mqiface
            
            
          
           Package mqiface provides an interface to enable mocking the AmazonMQ service client for testing your code. | Package mqiface provides an interface to enable mocking the AmazonMQ service client for testing your code. | 
| 
          
            mturk
            
            
          
           Package mturk provides the client and types for making API requests to Amazon Mechanical Turk. | Package mturk provides the client and types for making API requests to Amazon Mechanical Turk. | 
| 
          
            mturk/mturkiface
            
            
          
           Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code. | Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code. | 
| 
          
            neptune
            
            
          
           Package neptune provides the client and types for making API requests to Amazon Neptune. | Package neptune provides the client and types for making API requests to Amazon Neptune. | 
| 
          
            neptune/neptuneiface
            
            
          
           Package neptuneiface provides an interface to enable mocking the Amazon Neptune service client for testing your code. | Package neptuneiface provides an interface to enable mocking the Amazon Neptune service client for testing your code. | 
| 
          
            opsworks
            
            
          
           Package opsworks provides the client and types for making API requests to AWS OpsWorks. | Package opsworks provides the client and types for making API requests to AWS OpsWorks. | 
| 
          
            opsworks/opsworksiface
            
            
          
           Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code. | Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code. | 
| 
          
            opsworkscm
            
            
          
           Package opsworkscm provides the client and types for making API requests to AWS OpsWorks for Chef Automate. | Package opsworkscm provides the client and types for making API requests to AWS OpsWorks for Chef Automate. | 
| 
          
            opsworkscm/opsworkscmiface
            
            
          
           Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks for Chef Automate service client for testing your code. | Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks for Chef Automate service client for testing your code. | 
| 
          
            organizations
            
            
          
           Package organizations provides the client and types for making API requests to AWS Organizations. | Package organizations provides the client and types for making API requests to AWS Organizations. | 
| 
          
            organizations/organizationsiface
            
            
          
           Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code. | Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code. | 
| 
          
            pi
            
            
          
           Package pi provides the client and types for making API requests to AWS Performance Insights. | Package pi provides the client and types for making API requests to AWS Performance Insights. | 
| 
          
            pi/piiface
            
            
          
           Package piiface provides an interface to enable mocking the AWS Performance Insights service client for testing your code. | Package piiface provides an interface to enable mocking the AWS Performance Insights service client for testing your code. | 
| 
          
            pinpoint
            
            
          
           Package pinpoint provides the client and types for making API requests to Amazon Pinpoint. | Package pinpoint provides the client and types for making API requests to Amazon Pinpoint. | 
| 
          
            pinpoint/pinpointiface
            
            
          
           Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code. | Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code. | 
| 
          
            polly
            
            
          
           Package polly provides the client and types for making API requests to Amazon Polly. | Package polly provides the client and types for making API requests to Amazon Polly. | 
| 
          
            polly/pollyiface
            
            
          
           Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code. | Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code. | 
| 
          
            pricing
            
            
          
           Package pricing provides the client and types for making API requests to AWS Price List Service. | Package pricing provides the client and types for making API requests to AWS Price List Service. | 
| 
          
            pricing/pricingiface
            
            
          
           Package pricingiface provides an interface to enable mocking the AWS Price List Service service client for testing your code. | Package pricingiface provides an interface to enable mocking the AWS Price List Service service client for testing your code. | 
| 
          
            rds
            
            
          
           Package rds provides the client and types for making API requests to Amazon Relational Database Service. | Package rds provides the client and types for making API requests to Amazon Relational Database Service. | 
| 
          
            rds/rdsiface
            
            
          
           Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code. | Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code. | 
| 
          
            rds/rdsutils
            
            
          
           Package rdsutils is used to generate authentication tokens used to connect to a givent Amazon Relational Database Service (RDS) database. | Package rdsutils is used to generate authentication tokens used to connect to a givent Amazon Relational Database Service (RDS) database. | 
| 
          
            redshift
            
            
          
           Package redshift provides the client and types for making API requests to Amazon Redshift. | Package redshift provides the client and types for making API requests to Amazon Redshift. | 
| 
          
            redshift/redshiftiface
            
            
          
           Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code. | Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code. | 
| 
          
            rekognition
            
            
          
           Package rekognition provides the client and types for making API requests to Amazon Rekognition. | Package rekognition provides the client and types for making API requests to Amazon Rekognition. | 
| 
          
            rekognition/rekognitioniface
            
            
          
           Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code. | Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code. | 
| 
          
            resourcegroups
            
            
          
           Package resourcegroups provides the client and types for making API requests to AWS Resource Groups. | Package resourcegroups provides the client and types for making API requests to AWS Resource Groups. | 
| 
          
            resourcegroups/resourcegroupsiface
            
            
          
           Package resourcegroupsiface provides an interface to enable mocking the AWS Resource Groups service client for testing your code. | Package resourcegroupsiface provides an interface to enable mocking the AWS Resource Groups service client for testing your code. | 
| 
          
            resourcegroupstaggingapi
            
            
          
           Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API. | Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API. | 
| 
          
            resourcegroupstaggingapi/resourcegroupstaggingapiiface
            
            
          
           Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code. | Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code. | 
| 
          
            route53
            
            
          
           Package route53 provides the client and types for making API requests to Amazon Route 53. | Package route53 provides the client and types for making API requests to Amazon Route 53. | 
| 
          
            route53/route53iface
            
            
          
           Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code. | Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code. | 
| 
          
            route53domains
            
            
          
           Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains. | Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains. | 
| 
          
            route53domains/route53domainsiface
            
            
          
           Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code. | Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code. | 
| 
          
            s3
            
            
          
           Package s3 provides the client and types for making API requests to Amazon Simple Storage Service. | Package s3 provides the client and types for making API requests to Amazon Simple Storage Service. | 
| 
          
            s3/s3crypto
            
            
          
           Package s3crypto provides encryption to S3 using KMS and AES GCM. | Package s3crypto provides encryption to S3 using KMS and AES GCM. | 
| 
          
            s3/s3iface
            
            
          
           Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code. | Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code. | 
| 
          
            s3/s3manager
            
            
          
           Package s3manager provides utilities to upload and download objects from S3 concurrently. | Package s3manager provides utilities to upload and download objects from S3 concurrently. | 
| 
          
            s3/s3manager/s3manageriface
            
            
          
           Package s3manageriface provides an interface for the s3manager package | Package s3manageriface provides an interface for the s3manager package | 
| 
          
            sagemaker
            
            
          
           Package sagemaker provides the client and types for making API requests to Amazon SageMaker Service. | Package sagemaker provides the client and types for making API requests to Amazon SageMaker Service. | 
| 
          
            sagemaker/sagemakeriface
            
            
          
           Package sagemakeriface provides an interface to enable mocking the Amazon SageMaker Service service client for testing your code. | Package sagemakeriface provides an interface to enable mocking the Amazon SageMaker Service service client for testing your code. | 
| 
          
            sagemakerruntime
            
            
          
           Package sagemakerruntime provides the client and types for making API requests to Amazon SageMaker Runtime. | Package sagemakerruntime provides the client and types for making API requests to Amazon SageMaker Runtime. | 
| 
          
            sagemakerruntime/sagemakerruntimeiface
            
            
          
           Package sagemakerruntimeiface provides an interface to enable mocking the Amazon SageMaker Runtime service client for testing your code. | Package sagemakerruntimeiface provides an interface to enable mocking the Amazon SageMaker Runtime service client for testing your code. | 
| 
          
            secretsmanager
            
            
          
           Package secretsmanager provides the client and types for making API requests to AWS Secrets Manager. | Package secretsmanager provides the client and types for making API requests to AWS Secrets Manager. | 
| 
          
            secretsmanager/secretsmanageriface
            
            
          
           Package secretsmanageriface provides an interface to enable mocking the AWS Secrets Manager service client for testing your code. | Package secretsmanageriface provides an interface to enable mocking the AWS Secrets Manager service client for testing your code. | 
| 
          
            serverlessapplicationrepository
            
            
          
           Package serverlessapplicationrepository provides the client and types for making API requests to AWSServerlessApplicationRepository. | Package serverlessapplicationrepository provides the client and types for making API requests to AWSServerlessApplicationRepository. | 
| 
          
            serverlessapplicationrepository/serverlessapplicationrepositoryiface
            
            
          
           Package serverlessapplicationrepositoryiface provides an interface to enable mocking the AWSServerlessApplicationRepository service client for testing your code. | Package serverlessapplicationrepositoryiface provides an interface to enable mocking the AWSServerlessApplicationRepository service client for testing your code. | 
| 
          
            servicecatalog
            
            
          
           Package servicecatalog provides the client and types for making API requests to AWS Service Catalog. | Package servicecatalog provides the client and types for making API requests to AWS Service Catalog. | 
| 
          
            servicecatalog/servicecatalogiface
            
            
          
           Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code. | Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code. | 
| 
          
            servicediscovery
            
            
          
           Package servicediscovery provides the client and types for making API requests to Amazon Route 53 Auto Naming. | Package servicediscovery provides the client and types for making API requests to Amazon Route 53 Auto Naming. | 
| 
          
            servicediscovery/servicediscoveryiface
            
            
          
           Package servicediscoveryiface provides an interface to enable mocking the Amazon Route 53 Auto Naming service client for testing your code. | Package servicediscoveryiface provides an interface to enable mocking the Amazon Route 53 Auto Naming service client for testing your code. | 
| 
          
            ses
            
            
          
           Package ses provides the client and types for making API requests to Amazon Simple Email Service. | Package ses provides the client and types for making API requests to Amazon Simple Email Service. | 
| 
          
            ses/sesiface
            
            
          
           Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code. | Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code. | 
| 
          
            sfn
            
            
          
           Package sfn provides the client and types for making API requests to AWS Step Functions. | Package sfn provides the client and types for making API requests to AWS Step Functions. | 
| 
          
            sfn/sfniface
            
            
          
           Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code. | Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code. | 
| 
          
            shield
            
            
          
           Package shield provides the client and types for making API requests to AWS Shield. | Package shield provides the client and types for making API requests to AWS Shield. | 
| 
          
            shield/shieldiface
            
            
          
           Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code. | Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code. | 
| 
          
            simpledb
            
            
          
           Package simpledb provides the client and types for making API requests to Amazon SimpleDB. | Package simpledb provides the client and types for making API requests to Amazon SimpleDB. | 
| 
          
            simpledb/simpledbiface
            
            
          
           Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code. | Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code. | 
| 
          
            sms
            
            
          
           Package sms provides the client and types for making API requests to AWS Server Migration Service. | Package sms provides the client and types for making API requests to AWS Server Migration Service. | 
| 
          
            sms/smsiface
            
            
          
           Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code. | Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code. | 
| 
          
            snowball
            
            
          
           Package snowball provides the client and types for making API requests to Amazon Import/Export Snowball. | Package snowball provides the client and types for making API requests to Amazon Import/Export Snowball. | 
| 
          
            snowball/snowballiface
            
            
          
           Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code. | Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code. | 
| 
          
            sns
            
            
          
           Package sns provides the client and types for making API requests to Amazon Simple Notification Service. | Package sns provides the client and types for making API requests to Amazon Simple Notification Service. | 
| 
          
            sns/snsiface
            
            
          
           Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code. | Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code. | 
| 
          
            sqs
            
            
          
           Package sqs provides the client and types for making API requests to Amazon Simple Queue Service. | Package sqs provides the client and types for making API requests to Amazon Simple Queue Service. | 
| 
          
            sqs/sqsiface
            
            
          
           Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code. | Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code. | 
| 
          
            ssm
            
            
          
           Package ssm provides the client and types for making API requests to Amazon Simple Systems Manager (SSM). | Package ssm provides the client and types for making API requests to Amazon Simple Systems Manager (SSM). | 
| 
          
            ssm/ssmiface
            
            
          
           Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code. | Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code. | 
| 
          
            storagegateway
            
            
          
           Package storagegateway provides the client and types for making API requests to AWS Storage Gateway. | Package storagegateway provides the client and types for making API requests to AWS Storage Gateway. | 
| 
          
            storagegateway/storagegatewayiface
            
            
          
           Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code. | Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code. | 
| 
          
            sts
            
            
          
           Package sts provides the client and types for making API requests to AWS Security Token Service. | Package sts provides the client and types for making API requests to AWS Security Token Service. | 
| 
          
            sts/stsiface
            
            
          
           Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code. | Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code. | 
| 
          
            support
            
            
          
           Package support provides the client and types for making API requests to AWS Support. | Package support provides the client and types for making API requests to AWS Support. | 
| 
          
            support/supportiface
            
            
          
           Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code. | Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code. | 
| 
          
            swf
            
            
          
           Package swf provides the client and types for making API requests to Amazon Simple Workflow Service. | Package swf provides the client and types for making API requests to Amazon Simple Workflow Service. | 
| 
          
            swf/swfiface
            
            
          
           Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code. | Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code. | 
| 
          
            transcribeservice
            
            
          
           Package transcribeservice provides the client and types for making API requests to Amazon Transcribe Service. | Package transcribeservice provides the client and types for making API requests to Amazon Transcribe Service. | 
| 
          
            transcribeservice/transcribeserviceiface
            
            
          
           Package transcribeserviceiface provides an interface to enable mocking the Amazon Transcribe Service service client for testing your code. | Package transcribeserviceiface provides an interface to enable mocking the Amazon Transcribe Service service client for testing your code. | 
| 
          
            translate
            
            
          
           Package translate provides the client and types for making API requests to Amazon Translate. | Package translate provides the client and types for making API requests to Amazon Translate. | 
| 
          
            translate/translateiface
            
            
          
           Package translateiface provides an interface to enable mocking the Amazon Translate service client for testing your code. | Package translateiface provides an interface to enable mocking the Amazon Translate service client for testing your code. | 
| 
          
            waf
            
            
          
           Package waf provides the client and types for making API requests to AWS WAF. | Package waf provides the client and types for making API requests to AWS WAF. | 
| 
          
            waf/wafiface
            
            
          
           Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code. | Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code. | 
| 
          
            wafregional
            
            
          
           Package wafregional provides the client and types for making API requests to AWS WAF Regional. | Package wafregional provides the client and types for making API requests to AWS WAF Regional. | 
| 
          
            wafregional/wafregionaliface
            
            
          
           Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code. | Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code. | 
| 
          
            workdocs
            
            
          
           Package workdocs provides the client and types for making API requests to Amazon WorkDocs. | Package workdocs provides the client and types for making API requests to Amazon WorkDocs. | 
| 
          
            workdocs/workdocsiface
            
            
          
           Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code. | Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code. | 
| 
          
            workmail
            
            
          
           Package workmail provides the client and types for making API requests to Amazon WorkMail. | Package workmail provides the client and types for making API requests to Amazon WorkMail. | 
| 
          
            workmail/workmailiface
            
            
          
           Package workmailiface provides an interface to enable mocking the Amazon WorkMail service client for testing your code. | Package workmailiface provides an interface to enable mocking the Amazon WorkMail service client for testing your code. | 
| 
          
            workspaces
            
            
          
           Package workspaces provides the client and types for making API requests to Amazon WorkSpaces. | Package workspaces provides the client and types for making API requests to Amazon WorkSpaces. | 
| 
          
            workspaces/workspacesiface
            
            
          
           Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code. | Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code. | 
| 
          
            xray
            
            
          
           Package xray provides the client and types for making API requests to AWS X-Ray. | Package xray provides the client and types for making API requests to AWS X-Ray. | 
| 
          
            xray/xrayiface
            
            
          
           Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code. | Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code. |